spacer

EBI Dbfetch

ID   EU290672; SV 1; linear; genomic DNA; STD; HUM; 942 BP.
XX
AC   EU290672;
XX
DT   16-DEC-2008 (Rel. 98, Created)
DT   12-DEC-2012 (Rel. 115, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-G) gene, HLA-G-ML1699New allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-942
RX   DOI; 10.1016/j.humimm.2008.05.007.
RX   PUBMED; 18577408.
RA   Turk W.J., Mao X.J., Bielawny T., Brunham R., Luo M., Plummer F.A.;
RT   "Identification of novel human leukocyte antigen G alleles in an East
RT   African population by high-resolution sequence-based typing";
RL   Hum. Immunol. 69(7):426-429(2008).
XX
RN   [2]
RP   1-942
RA   Turk W.J.R., Mao X.-J., Bielawny T., Brunham R., Luo M., Plummer F.;
RT   ;
RL   Submitted (20-NOV-2007) to the INSDC.
RL   Medical Microbiology, University of Manitoba, 730 William Avenue, Winnipeg,
RL   Manitoba R3E 0W3, Canada
XX
DR   MD5; c17267181583eae1b2c2983a528c5354.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..942
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>942
FT                   /gene="HLA-G"
FT                   /allele="ML1699New"
FT   intron          <1..79
FT                   /gene="HLA-G"
FT                   /allele="ML1699New"
FT                   /number=1
FT   mRNA            join(<80..349,576..>851)
FT                   /gene="HLA-G"
FT                   /allele="ML1699New"
FT                   /product="MHC class I antigen"
FT   CDS             join(<80..349,576..>851)
FT                   /codon_start=3
FT                   /gene="HLA-G"
FT                   /allele="ML1699New"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B7SFZ2"
FT                   /db_xref="IMGT/HLA:G*01:10"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B7SFZ2"
FT                   /protein_id="ACA50440.1"
FT                   /translation="SHSMRYFSAAVSRPGRGEPRFIAMGYVDDMQFVRFDSDSACPRME
FT                   PRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGS
FT                   DGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTC
FT                   VEWLHRYLENGKEMLQRA"
FT   exon            80..349
FT                   /gene="HLA-G"
FT                   /allele="ML1699New"
FT                   /number=2
FT   intron          350..575
FT                   /gene="HLA-G"
FT                   /allele="ML1699New"
FT                   /number=2
FT   exon            576..851
FT                   /gene="HLA-G"
FT                   /allele="ML1699New"
FT                   /number=3
FT   intron          852..>942
FT                   /gene="HLA-G"
FT                   /allele="ML1699New"
FT                   /number=3
XX
SQ   Sequence 942 BP; 182 A; 303 C; 330 G; 127 T; 0 other;
     ccggcccggc gggggcgcag gactcggcag ccgcgccggg aggagggtcg ggcgggtctc        60
     aacccctcct cgcccccagg ctcccactcc atgaggtatt tcagcgccgc cgtgtcccgg       120
     cccggccgcg gggagccccg cttcatcgcc atgggctacg tggacgacat gcagttcgtg       180
     cggttcgaca gcgactcggc gtgtccgagg atggagccgc gggcgccgtg ggtggagcag       240
     gaggggccgg agtattggga agaggagaca cggaacacca aggcccacgc acagactgac       300
     agaatgaacc tgcagaccct gcgcggctac tacaaccaga gcgaggccag tgagtaactc       360
     cggcccaggg agcagatcac gacccccacc tccatgcccc acggacggcc cgggtactcc       420
     cgagtctccg ggtctgggat ccaccccgag gccgcgggac ccgcccagac cctctacctg       480
     ggagaacccc aaggcgcctt taccaaaatc cccgcgggtg ggtccgggcg agggcgaggc       540
     tcggtgggcg gggctgaccg agggggtggg gccaggttct cacaccctcc agtggatgat       600
     tggctgcgac ctggggtccg acggacgcct cctccgcggg tatgaacagt atgcctacga       660
     tggcaaggat tacctcgccc tgaacgagga cctgcgctcc tggaccgcag cggacactgc       720
     ggctcagatc tccaagcgca agtgtgaggc ggccaatgtg gctgaacaaa ggagagccta       780
     cctggagggc acgtgcgtgg agtggctcca cagatacctg gagaacggga aggagatgct       840
     gcagcgcgcg ggtaccaggg gcagtggggc gcctccctga tctcctgtag acctctcagc       900
     ctggcctagc acaaggagag gaggaaaatg ggaccaacac ta                          942
//


spacer
spacer