spacer

EBI Dbfetch

ID   EU275157; SV 1; linear; genomic DNA; STD; HUM; 682 BP.
XX
AC   EU275157;
XX
DT   25-DEC-2007 (Rel. 94, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens isolate NT00757 MHC class II antigen (HLA-DQB1) gene,
DE   HLA-DQB1*030101 variant allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-682
RA   Lazaro A.M., Xiao Y., Tu B., Hurley C.K.;
RT   "Novel HLA class II allele";
RL   Unpublished.
XX
RN   [2]
RP   1-682
RA   Lazaro A.M., Xiao Y., Tu B., Hurley C.K.;
RT   ;
RL   Submitted (12-NOV-2007) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Tr; ENST00000399065; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000424530; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..682
FT                   /organism="Homo sapiens"
FT                   /isolate="NT00757"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>682
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*030101 variant"
FT   mRNA            join(<1..270,401..>682)
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*030101 variant"
FT                   /product="MHC class II antigen"
FT   CDS             join(<1..270,401..>682)
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*030101 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:A9YQ99"
FT                   /db_xref="IMGT/HLA:DQB1*03:01:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A9YQ99"
FT                   /protein_id="ABY26530.1"
FT                   /translation="DFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAV
FT                   TPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEAL
FT                   NHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHG
FT                   DVYTCHVEHPSLQNPITVEW"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*030101 variant"
FT                   /number=2
FT   gap             271..400
FT                   /estimated_length=130
FT   exon            401..682
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*030101 variant"
FT                   /number=3
XX
SQ   Sequence 682 BP; 128 A; 164 C; 162 G; 98 T; 130 other;
     aggatttcgt gtaccagttt aaggccatgt gctacttcac caacgggacg gagcgcgtgc        60
     gttatgtgac cagatacatc tataaccgag aggagtacgc acgcttcgac agcgacgtgg       120
     aggtgtaccg ggcggtgacg ccgctggggc cgcctgacgc cgagtactgg aacagccaga       180
     aggaagtcct ggagaggacc cgggcggagt tggacacggt gtgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn tggagcccac agtgaccatc       420
     tccccatcca ggacagaggc cctcaaccac cacaacctgc tggtctgctc agtgacagat       480
     ttctatccag cccagatcaa agtccggtgg tttcggaatg accaggagga gacaaccggc       540
     gttgtgtcca ccccccttat taggaacggt gactggacct tccagatcct ggtgatgctg       600
     gaaatgactc cccagcatgg agatgtctac acctgccacg tggagcaccc cagcctccag       660
     aaccccatca ccgtggagtg gc                                                682
//


spacer
spacer