Dbfetch

ID   EU254723; SV 1; linear; genomic DNA; STD; HUM; 1927 BP.
XX
AC   EU254723;
XX
DT   28-NOV-2007 (Rel. 93, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I chain-related protein A (MICA) gene, MICA*TM A8
DE   allele, exons 2 through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1927
RX   DOI; 10.1111/j.1399-0039.2008.01098.x.
RX   PUBMED; 18647364.
RA   Glas J., Maier K., Wetzke M., Henninger M., Weiss E.H., Folwaczny M.;
RT   "MICA*055: a new allele with eight GCT repeats in the exon 5
RT   microsatellite";
RL   Tissue Antigens 72(4):410-411(2008).
XX
RN   [2]
RP   1-1927
RA   Glas J., Maier K., Wetzke M., Henninger M., Euba A., Weiss E.H.,
RA   Folwaczny M.;
RT   ;
RL   Submitted (30-OCT-2007) to the INSDC.
RL   Clinic for Preventive Dentistry and Periodontology, University of Munich,
RL   Goethestrasse 70, Munich 80336, Germany
XX
DR   MD5; 35ea5316cb76847c22bf87e9f9f5796b.
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; EU254723.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1927
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="P218-24"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1927
FT                   /gene="MICA"
FT                   /allele="MICA*TM A8"
FT   mRNA            join(<1..255,530..817,1405..1683,1784..>1927)
FT                   /gene="MICA"
FT                   /allele="MICA*TM A8"
FT                   /product="MHC class I chain-related protein A"
FT   CDS             join(<1..255,530..817,1405..1683,1784..>1927)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /allele="MICA*TM A8"
FT                   /product="MHC class I chain-related protein A"
FT                   /note="MHC class I molecule"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="IMGT/HLA:MICA*055"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="ABX54884.1"
FT                   /translation="PHSLRYNLTVLSGDGSVQSGFLAEVHLDGQPFLRCDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQS
FT                   HWQTFHVSAVAAAAAAAAIFVIIIFYVCCCKKKTSAAEGP"
FT   exon            1..255
FT                   /gene="MICA"
FT                   /allele="MICA*TM A8"
FT                   /number=2
FT   exon            530..817
FT                   /gene="MICA"
FT                   /allele="MICA*TM A8"
FT                   /number=3
FT   exon            1405..1683
FT                   /gene="MICA"
FT                   /allele="MICA*TM A8"
FT                   /number=4
FT   exon            1784..1927
FT                   /gene="MICA"
FT                   /allele="MICA*TM A8"
FT                   /number=5
FT   repeat_region   1837..1860
FT                   /rpt_type=TANDEM
FT                   /rpt_unit_seq="gct"
FT                   /satellite="microsatellite"
XX
SQ   Sequence 1927 BP; 438 A; 508 C; 583 G; 398 T; 0 other;
     agccccacag tcttcgttat aacctcacgg tgctgtccgg ggatggatct gtgcagtcag        60
     ggtttctcgc tgaggtacat ctggatggtc agcccttcct gcgctgtgac aggcagaaat       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggaaataag acatgggaca       180
     gagagaccag ggacttgaca gggaacggaa aggacctcag gatgaccctg gctcatatca       240
     aggaccagaa agaaggtgag agtcggcagg ggcaagagtg actggagagg ccttttccag       300
     aaaagttagg ggcagagagc agggacctgt atctacccac tggatctggc tcaggctggg       360
     ggtgaggaat gggggtcagt ggaactcagc agggaggtga gccggcactc agcccacaca       420
     gggaggcatg gaggagggcc agggaggcgt accccctggg ctgagttcct cacttgggtg       480
     gaaaggtgat gggttcggga atggagaagt cactgctggg tgggggcagg cttgcattcc       540
     ctccaggaga ttagggtctg tgagatccat gaagacaaca gcaccaggag ctcccagcat       600
     ttctactacg atggggagct cttcctctcc caaaacctgg agactgagga atggacaatg       660
     ccccagtcct ccagagctca gaccttggcc atgaacgtca ggaatttctt gaaggaagat       720
     gccatgaaga ccaagacaca ctatcacgct atgcatgcag actgcctgca ggaactacgg       780
     cgatatctaa aatccggcgt agtcctgagg agaacaggta ccgacgctgg ccaggggctc       840
     tcctctcctt ccaattctgc tagagttgcc tcacctccca gatgtgtcca gggaaaccct       900
     ccctgtgcta tggatgaagg catttcctgt tggcacatcg tgtcctgatt ttcctctatt       960
     gttagagcca ctggataaag acagtgggtc agggactgga ccatccagtg ttgtaatcag      1020
     ggcaagtaga ggaccctccg acagaatcct gagcctgggg tgggtgtcag gcaggagagg      1080
     aaggcttcag ggccagggct gccccctctg cctcccagcc tgcccatcct ggagagttcc      1140
     ctcctggccc cacaacccag gagtccaccc ctgacatccc cctcctcagc atcaatgtgg      1200
     ggatcccaga gcctgaggcc acagtcccat ggcccatcct cctgccagcc tggaagaact      1260
     gggccccaga gtgaggacag acttgcaggt caggggtccc agagggcttc agccagagtg      1320
     agaacagtga agagaaacag ccctgttcct ctcccctcct tagaggggag cagggcttca      1380
     ctggctctgc cctttcttct ccagtgcccc ccatggtgaa tgtcacccgc agcgaggcct      1440
     cagagggcaa cattaccgtg acatgcaggg cttctggctt ctatccctgg aatatcacac      1500
     tgagctggcg tcaggatggg gtatctttga gccacgacac ccagcagtgg ggggatgtcc      1560
     tgcctgatgg gaatggaacc taccagacct gggtggccac caggatttgc caaggagagg      1620
     agcagaggtt cacctgctac atggaacaca gcgggaatca cagcactcac cctgtgccct      1680
     ctggtgagcc tagggtgacc ctggagaggg tcaggccagg gtagggacag cagggatggc      1740
     tgtggctctc tgcccagtgt ataacaagtc cctttttttt cagggaaagt gctggtgctt      1800
     cagagtcatt ggcagacatt ccatgtttct gctgttgctg ctgctgctgc tgctgctgct      1860
     atttttgtta ttattatttt ctacgtctgt tgttgtaaga agaaaacatc agctgcagag      1920
     ggtccag                                                                1927
//