spacer

EBI Dbfetch

ID   EU253478; SV 1; linear; genomic DNA; STD; HUM; 1642 BP.
XX
AC   EU253478;
XX
DT   31-JAN-2008 (Rel. 94, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*23new allele, exons 2
DE   through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1642
RX   DOI; 10.1111/j.1399-0039.2008.01041.x.
RX   PUBMED; 18380774.
RA   Aureli A., Del Beato T., Papola F., Adorno D., Piancatelli D.;
RT   "A new HLA-A allele identified in a leukemic patient attending
RT   hematopoietic cell transplantation: A*2318";
RL   Tissue Antigens 71(6):568-569(2008).
XX
RN   [2]
RP   1-1642
RA   Aureli A., Piancatelli D., Del Beato T., Azzarone R., Papola F., Adorno D.;
RT   ;
RL   Submitted (30-OCT-2007) to the INSDC.
RL   CNR, Institute for Organ Transplantation and Immunocytology, P.le
RL   Collemaggio, L'Aquila 67100, Italy
XX
DR   MD5; a66309f8fcb3a2006ebc3112dea2e5a6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1642
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="F438"
FT                   /mol_type="genomic DNA"
FT                   /country="Italy"
FT                   /isolation_source="potential bone marrow recipient"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1642
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*23new"
FT   mRNA            join(<1..270,512..787,1367..>1642)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*23new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..787,1367..>1642)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*23new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B0LL97"
FT                   /db_xref="IMGT/HLA:A*23:18"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B0LL97"
FT                   /protein_id="ABY74323.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQQDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*23new"
FT                   /number=2
FT   gap             271..511
FT                   /estimated_length=241
FT   exon            512..787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*23new"
FT                   /number=3
FT   gap             788..1366
FT                   /estimated_length=579
FT   exon            1367..1642
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*23new"
FT                   /number=4
FT   variation       1475
FT                   /gene="HLA-A"
FT                   /replace="g"
FT                   /note="compared to HLA-A*2301"
XX
SQ   Sequence 1642 BP; 171 A; 250 C; 279 G; 122 T; 820 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acgaggagac agggaaagtg aaggcccact cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngttctcaca ccctccagat gatgtttggc       540
     tgcgacgtgg ggtcggacgg gcgcttcctc cgcgggtacc accagtacgc ctacgacggc       600
     aaggattaca tcgccctgaa agaggacctg cgctcttgga ccgcggcgga catggcggct       660
     cagatcaccc agcgcaagtg ggaggcggcc cgtgtggcgg agcagttgag agcctacctg       720
     gagggcacgt gcgtggacgg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacggnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnaccc ccccaagaca      1380
     catatgaccc accaccccat ctctgaccat gaggccactc tgagatgctg ggccctgggc      1440
     ttctaccctg cggagatcac actgacctgg cagcaggatg gggaggacca gacccaggac      1500
     acggagcttg tggagaccag gcctgcaggg gatggaacct tccagaagtg ggcagctgtg      1560
     gtggtacctt ctggagagga gcagagatac acctgccatg tgcagcatga gggtctgccc      1620
     aagcccctca ccctgagatg gg                                               1642
//


spacer
spacer