Dbfetch

ID   EU220991; SV 1; linear; genomic DNA; STD; HUM; 1022 BP.
XX
AC   EU220991;
XX
DT   11-MAR-2008 (Rel. 95, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-G) gene, HLA-G000000 allele, exons 2
DE   through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1022
RX   DOI; 10.1111/j.1399-0039.2007.01000.x.
RX   PUBMED; 18194366.
RA   Arnaiz-Villena A., Serrano-Vela J.I., Reguera R., Perez-Saborido B.,
RA   Moreno E., Moscoso J.;
RT   "A novel allele, HLA-G*010114, with a non-coding DNA base change in exon
RT   2";
RL   Tissue Antigens 71(3):258-259(2008).
XX
RN   [2]
RP   1-1022
RA   Arnaiz-Villena A.;
RT   ;
RL   Submitted (16-OCT-2007) to the INSDC.
RL   Immunology, Universidad Complutense de Madrid, Avenida Complutense s/n,
RL   Madrid 28040, Spain
XX
DR   MD5; 9efbb80f4592e25d4ae2d4b09da9577b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1022
FT                   /organism="Homo sapiens"
FT                   /isolate="TXH12-2R3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1022
FT                   /gene="HLA-G"
FT                   /allele="HLA-G000000"
FT   mRNA            join(<1..270,371..646,747..>1022)
FT                   /gene="HLA-G"
FT                   /allele="HLA-G000000"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..646,747..>1022)
FT                   /codon_start=3
FT                   /gene="HLA-G"
FT                   /allele="HLA-G000000"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:G*01:01:14"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B1P198"
FT                   /protein_id="ABY21168.1"
FT                   /translation="SHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRME
FT                   PRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGS
FT                   DGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTC
FT                   VEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGED
FT                   QTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRW"
FT   exon            <1..270
FT                   /gene="HLA-G"
FT                   /allele="HLA-G000000"
FT                   /number=2
FT                   /note="alpha 1 domain"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-G"
FT                   /allele="HLA-G000000"
FT                   /number=3
FT                   /note="alpha 2 domain"
FT   gap             647..746
FT                   /estimated_length=unknown
FT   exon            747..>1022
FT                   /gene="HLA-G"
FT                   /allele="HLA-G000000"
FT                   /number=4
FT                   /note="alpha 3 domain"
XX
SQ   Sequence 1022 BP; 173 A; 242 C; 280 G; 127 T; 200 other;
     gctcccactc catgaggtat ttcagcgccg ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc catgggctac gtggacgaca cgcagttcgt gcgattcgac agcgactcgg       120
     cgtgtccgag gatggagccg cgggcgccgt gggtggagca ggaggggcca gagtattggg       180
     aagaggagac acggaacacc aaggcccacg cacagactga cagaatgaac ctgcagaccc       240
     tgcgcggcta ctacaaccag agcgaggcca nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcatac cctccagtgg atgattggct gcgacctggg gtccgacgga       420
     cgcctcctcc gcgggtatga acagtatgcc tacgatggca aggattacct cgccctgaac       480
     gaggacctgc gctcctggac cgcagcggac actgcggctc agatctccaa gcgcaagtgt       540
     gaggcggcca atgtggctga acaaaggaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccacagat acctggagaa cgggaaggag atgctgcagc gcgcggnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnaccc ccccaagaca cacgtgaccc accaccctgt       780
     ctttgactat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcat       840
     actgacctgg cagcgggatg gggaggacca gacccaggac gtggagctcg tggagaccag       900
     gcctgcaggg gatggaacct tccagaagtg ggcagctgtg gtggtgcctt ctggagagga       960
     gcagagatac acgtgccatg tgcagcatga ggggctgccg gagcccctca tgctgagatg      1020
     ga                                                                     1022
//