Dbfetch

ID   EU189866; SV 2; linear; genomic DNA; STD; HUM; 3060 BP.
XX
AC   EU189866;
XX
DT   01-NOV-2007 (Rel. 93, Created)
DT   27-OCT-2009 (Rel. 102, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*6802 variant allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3060
RX   DOI; 10.1111/j.1399-0039.2009.01365.x.
RX   PUBMED; 19845899.
RA   Serov Y., Hommel-Berrey G., Lobashevsky A.;
RT   "Identification of a novel HLA-A*680202 allele by sequence-based typing in
RT   an African American individual";
RL   Tissue Antigens 74(5):435-437(2009).
XX
RN   [2]
RP   1-3060
RA   Serov Y.A., Hommel-Berrey G.A., Lobashevsky A.L.;
RT   ;
RL   Submitted (03-OCT-2007) to the INSDC.
RL   Medicine, Indiana University (IUPUI), Riley Hospital, Room 0615, 702
RL   Barnhill Drive, Indianapolis, IN 46112, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-3060
RA   Serov Y.A., Hommel-Berrey G.A., Lobashevsky A.L.;
RT   ;
RL   Submitted (20-MAR-2008) to the INSDC.
RL   Medicine, Indiana University (IUPUI), Riley Hospital, Room 0615, 702
RL   Barnhill Drive, Indianapolis, IN 46112, USA
XX
DR   MD5; 1fe1a15def0525953b08a1c9beea67bc.
XX
CC   On Mar 20, 2008 this sequence version replaced gi:158516817.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3060
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>3060
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802 variant"
FT   mRNA            join(<1..73,204..473,715..990,1591..1866,1966..2082,
FT                   2521..2553,2696..2743,2913..>3060)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,715..990,1591..1866,1966..2082,
FT                   2521..2553,2696..2743,2913..2917)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q1ELT0"
FT                   /db_xref="IMGT/HLA:A*68:02:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q1ELT0"
FT                   /protein_id="ABW70165.2"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEAGSHTIQRMYGCDVGPDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   exon            <1..73
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802 variant"
FT                   /number=1
FT   exon            204..473
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802 variant"
FT                   /number=2
FT   exon            715..990
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802 variant"
FT                   /number=3
FT   variation       989
FT                   /gene="HLA-A"
FT                   /replace="g"
FT                   /note="T206T; compared to HLA-A*680201"
FT   exon            1591..1866
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802 variant"
FT                   /number=4
FT   exon            1966..2082
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802 variant"
FT                   /number=5
FT   exon            2521..2553
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802 variant"
FT                   /number=6
FT   exon            2696..2743
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802 variant"
FT                   /number=7
FT   exon            2913..>3060
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802 variant"
FT                   /number=8
FT   3'UTR           2918..>3060
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802 variant"
XX
SQ   Sequence 3060 BP; 597 A; 879 C; 947 G; 637 T; 0 other;
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggtgagtg cggggtcggg agggaaacgg cctctgtggg gagaagcaag       120
     gggcccgccc ggcgggggcg caggacccgg gaagccgcgc ctggaggagg gtcgggcggg       180
     tctcagccac tcctcgcccc caggctccca ctccatgagg tatttctaca cctccatgtc       240
     ccggcccggc cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       360
     gcaggagggg ccggagtatt gggaccggaa cacacggaat gtgaaggccc agtcacagac       420
     tgaccgagtg gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggtgagtg       480
     accccggccc ggggcgcagg tcacgacccc tcatccccca cggacgggcc aggtcgccca       540
     cagtctccgg gtccgagatc cgccccgaag ccgcgggacc ccgagaccct tgccccggga       600
     gaggcccagg cgcctttacc cggtttcatt ttcagtttag gccaaaaatc cccccgggtt       660
     ggtcggggcg gggcggggct cgggggaccg ggctgacctc ggggtccggg ccaggttctc       720
     acaccatcca gaggatgtat ggctgcgacg tggggccgga cgggcgcttc ctccgcgggt       780
     accaccagta cgcctacgac ggcaaggatt acatcgccct gaaagaggac ctgcgctctt       840
     ggaccgcggc ggacatggca gctcagacca ccaagcacaa gtgggaggcg gcccatgtgg       900
     cggagcagtg gagagcctac ctggagggca cgtgcgtgga gtggctccgc agatacctgg       960
     agaacgggaa ggagacgctg cagcgcactg gtaccagggg ccacggggcg cctccctgat      1020
     cgcctgtaga tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact      1080
     agaatatcgc cctccctctg gtcctgaggg agaggaatcc tcctgggttt ccagatcctg      1140
     taccagagag tgactctgag gttccgccct gctctctgac acaattaagg gataaaatct      1200
     ctgaaggaat gacgggaaga cgatccctcg aatactgatg agtggttccc tttgacacac      1260
     acaggcagca gccttgggcc cgtgactttt cctctcaggc cttgttctct gcttcacact      1320
     caatgtgtgt gggggtctga gtccagcact tctgagtccc tcagcctcca ctcaggtcag      1380
     gaccagaagt cgctgttccc tcttcaggga ctagaatttt ccacggaata ggagattatc      1440
     ccaggtgcct gtgtccaggc tggtgtctgg gttctgtgct cccttcccca tcccaggtgt      1500
     cctgtccatt ctcaagatag ccacatgtgt gctggaggag tgtcccatga cagatgcaaa      1560
     atgcctgaat gatctgactc ttcctgacag acgcccccaa aacgcatatg actcaccacg      1620
     ctgtctctga ccatgaagcc accctgaggt gctgggccct gagcttctac cctgcggaga      1680
     tcacactgac ctggcagcgg gatggggagg accagaccca ggacacggag ctcgtggaga      1740
     ccaggcctgc aggggatgga accttccaga agtgggtggc tgtggtggtg ccttctggac      1800
     aggagcagag atacacctgc catgtgcagc atgagggttt gcccaagccc ctcaccctga      1860
     gatggggtaa ggagggagac gggggtgtca tgtcttttag ggaaagcagg agcctctctg      1920
     acctttagca gggtcagggc ccctcacctt cccctctttt cccagagccg tcttcccagc      1980
     ccaccatccc catcgtgggc atcattgctg gcctggttct ctttggagct gtgatcactg      2040
     gagctgtggt cgctgctgtg atgtggagga ggaagagctc aggtggggaa ggggtgaagg      2100
     gtgggtctga gatttcttgt ctcactgagg gttccaagac ccaggtagaa gtgtgccctg      2160
     cctcgttact gggaagcacc acccacaatt atgggcctac ccagcctggg ccctgtgtgc      2220
     cagcacttac tcttttgtaa agcacctgtt aaaatgaagg acagatttat caccttgatt      2280
     acagcggtga tgggacctga tcccagcagt cacaagtcac aggggaaggt ccctgaggac      2340
     cttcaggagg gcggttggtc caggacccac acctgctttc ttcatgtttc ctgatcccgc      2400
     cctgggtctg cagtcacaca tttctggaaa cttctctgag gtccaagact tggaggttcc      2460
     tctaggacct taaggccctg actcctttct ggtatctcac aggacatttt cttcccacag      2520
     atagaaaagg agggagctac tctcaggctg caagtaagta tgaaggaggc tgatgcctga      2580
     ggtccttggg atattgtgtt tgggagccca tgggggagct cacccacccc acaattcctc      2640
     ctctagccac atcttctgtg ggatctgacc aggttctgtt tttgttctac cccaggcagt      2700
     gacagtgccc agggctctga tgtgtctctc acagcttgta aaggtgagag cctggagggc      2760
     ctgatgtgtg ttgggtgttg ggcggaacag tggacacagc tgtgctatgg ggtttctttc      2820
     cattggatgt attgagcatg cgatgggctg tttaaagtgt gacccctcac tgtgacagat      2880
     acgaatttgt tcatgaatat ttttttctat agtgtgagac agctgccttg tgtgggactg      2940
     agaggcaaga gcaaagacct gcatgtgtct gtgttcgtgt aggcataatg tgaggaggtg      3000
     gggagaccac cccaccccca tgtccaccat gaccctcttc ccacgctgac ctgtgctccc      3060
//