spacer

EBI Dbfetch

ID   EU184011; SV 1; linear; genomic DNA; STD; HUM; 825 BP.
XX
AC   EU184011;
XX
DT   01-NOV-2007 (Rel. 93, Created)
DT   01-NOV-2007 (Rel. 93, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*07 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-825
RA   Thomas D., Askar M., Ball E., Kawczak P., Jurcago R., Schatz H.,
RA   Smerglia A., Cook D., Pidwell D.;
RT   "HLA class I variant allele";
RL   Unpublished.
XX
RN   [2]
RP   1-825
RA   Thomas D., Askar M., Ball E., Kawczak P., Jurcago R., Schatz H.,
RA   Smerglia A., Cook D., Pidwell D.;
RT   ;
RL   Submitted (30-SEP-2007) to the INSDC.
RL   Allogen Laboratories, Cleveland Clinic, 9500 Euclid Avenue, Cleveland, OH
RL   44195, USA
XX
DR   MD5; 804d12fa94c4a935fbb904d40c7157bd.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..825
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <35..>825
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07 variant"
FT   mRNA            join(<35..304,550..>825)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<35..304,550..>825)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A8VU75"
FT                   /db_xref="IMGT/HLA:B*07:70"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A8VU75"
FT                   /protein_id="ABW38025.1"
FT                   /translation="SHSMRYFCTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGEC
FT                   VEWLRRYLENGKDKLERA"
FT   exon            35..304
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07 variant"
FT                   /number=2
FT   variation       59
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0702"
FT                   /replace="a"
FT   exon            550..>825
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07 variant"
FT                   /number=3
XX
SQ   Sequence 825 BP; 143 A; 279 C; 296 G; 107 T; 0 other;
     ggtcgggcgg gtctcagccc ctcctcaccc ccaggctccc actccatgag gtatttctgc        60
     acctccgtgt cccggcccgg ccgcggggag ccccgcttca tctcagtggg ctacgtggac       120
     gacacccagt tcgtgaggtt cgacagcgac gccgcgagtc cgagagagga gccgcgggcg       180
     ccgtggatag agcaggaggg gccggagtat tgggaccgga acacacagat ctacaaggcc       240
     caggcacaga ctgaccgaga gagcctgcgg aacctgcgcg gctactacaa ccagagcgag       300
     gccggtgagt gaccccggcc cggggcgcag gtcacgactc cccatccccc acgtacggcc       360
     cgggtcgccc cgagtctccg ggtccgagat ccgcctccct gaggccgcgg gacccgccca       420
     gaccctcgac cggcgagagc cccaggcgcg tttacccggt ttcattttca gttgaggcca       480
     aaatccccgc gggttggtcg gggcggggcg gggctcgggg gactgggctg accgcggggc       540
     cggggccagg gtctcacacc ctccagagca tgtacggctg cgacgtgggg ccggacgggc       600
     gcctcctccg cgggcatgac cagtacgcct acgacggcaa ggattacatc gccctgaacg       660
     aggacctgcg ctcctggacc gccgcggaca cggcggctca gatcacccag cgcaagtggg       720
     aggcggcccg tgaggcggag cagcggagag cctacctgga gggcgagtgc gtggagtggc       780
     tccgcagata cctggagaac gggaaggaca agctggagcg cgctg                       825
//


spacer
spacer