spacer

EBI Dbfetch

ID   EU169936; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EU169936;
XX
DT   01-NOV-2007 (Rel. 93, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*1502 variant allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Liu N., Shan X., Li W., Wang L., He X., Wang Z., Ni L., Cui S., Wang L.,
RA   Gong Z., Zhao B., Zhang Z.;
RT   "A novel HLA-Cw allele identified by sequence";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Liu N., Shan X., Li W., Wang L., He X., Wang Z., Ni L., Cui S., Wang L.,
RA   Gong Z., Zhao B., Zhang Z.;
RT   ;
RL   Submitted (24-SEP-2007) to the INSDC.
RL   HLA Lab, 37 North Third Ring Road, Beijing 100088, China
XX
DR   MD5; a2a1a126cf88ab4973f88861e0ed3c0e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1502 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1502 variant"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1502 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A8VGM8"
FT                   /db_xref="IMGT/HLA:C*15:02:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:A8VGM8"
FT                   /protein_id="ABV68908.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQNYKRQAQTDRVNLRKLRGYYNQSEA"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1502 variant"
FT                   /number=2
FT   variation       143
FT                   /gene="HLA-Cw"
FT                   /replace="g"
FT                   /note="R47R"
XX
SQ   Sequence 270 BP; 57 A; 84 C; 94 G; 35 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccggccgc ggagagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgcgcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaactac aagcgccagg cacagactga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer