spacer

EBI Dbfetch

ID   EU167538; SV 1; linear; genomic DNA; STD; HUM; 1642 BP.
XX
AC   EU167538;
XX
DT   16-OCT-2007 (Rel. 93, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A-*02 variant allele,
DE   exons 2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1642
RX   DOI; 10.1111/j.1399-0039.2008.01010.x.
RX   PUBMED; 18312482.
RA   Kelsch R., Binder T.M., Sibrowski W.;
RT   "Identification of the novel allele HLA-A*9237 in peripheral blood of a
RT   bone marrow donor";
RL   Tissue Antigens 71(5):480-481(2008).
XX
RN   [2]
RP   1-1642
RA   Kelsch R., Winkelhaus A., Sibrowski W.;
RT   "New HLA-A*02 variant related to HLA-A*0206 with amino acid exchange in
RT   exon 3";
RL   Unpublished.
XX
RN   [3]
RP   1-1642
RA   Kelsch R., Winkelhaus A., Sibrowski W.;
RT   ;
RL   Submitted (21-SEP-2007) to the INSDC.
RL   Institute of Transfusion Medicine, Transplant Immunology, University
RL   Clinics of Muenster, Domagkstr. 11, Muenster, NRW D-48149, Germany
XX
DR   MD5; a5ef45b9ceb661cec2e3cc60a827032f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1642
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1642
FT                   /gene="HLA-A"
FT                   /allele="*02 variant"
FT   mRNA            join(<1..270,512..787,1367..>1642)
FT                   /gene="HLA-A"
FT                   /allele="*02 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..787,1367..>1642)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="*02 variant"
FT                   /product="MHC class I antigen"
FT                   /note="antigen-presenting molecule; HLA-A2"
FT                   /db_xref="GOA:A8ILL3"
FT                   /db_xref="IMGT/HLA:A*02:137"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILL3"
FT                   /protein_id="ABW21689.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGS
FT                   DWRFLRGYHQYAYDGKDYIALNEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="*02 variant"
FT                   /number=2
FT   gap             271..511
FT                   /estimated_length=241
FT   exon            512..787
FT                   /gene="HLA-A"
FT                   /allele="*02 variant"
FT                   /number=3
FT   gap             788..1366
FT                   /estimated_length=579
FT   exon            1367..1642
FT                   /gene="HLA-A"
FT                   /allele="*02 variant"
FT                   /number=4
XX
SQ   Sequence 1642 BP; 170 A; 246 C; 282 G; 124 T; 820 other;
     gctctcactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagggtccg gagtattggg       180
     acggggagac acggaaagtg aaggcccact cacagactca ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngttctcaca ccgtccagag gatgtatggc       540
     tgcgacgtgg ggtcggactg gcgcttcctc cgcgggtacc accagtacgc ctacgacggc       600
     aaggattaca tcgccctgaa cgaggacctg cgctcttgga ccgcggcgga catggcagct       660
     cagaccacca agcacaagtg ggaggcggcc catgtggcgg agcagttgag agcctacctg       720
     gagggcacgt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacggnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnacgc ccccaaaacg      1380
     catatgactc accacgctgt ctctgaccat gaagccaccc tgaggtgctg ggccctgagc      1440
     ttctaccctg cggagatcac actgacctgg cagcgggatg gggaggacca gacccaggac      1500
     acggagctcg tggagaccag gcctgcaggg gatggaacct tccagaagtg ggcggctgtg      1560
     gtggtgcctt ctggacagga gcagagatac acctgccatg tgcagcatga gggtttgccc      1620
     aagcccctca ccctgagatg gg                                               1642
//


spacer
spacer