spacer

EBI Dbfetch

ID   EU153252; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   EU153252;
XX
DT   06-OCT-2007 (Rel. 93, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) gene, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Chu C.-C., Wang L.-Y., Lin H.-H.;
RT   "A new DPB1 allele with silent mutation";
RL   Unpublished.
XX
RN   [2]
RP   1-276
RA   Wang L.-Y.;
RT   ;
RL   Submitted (01-OCT-2007) to the INSDC.
RL   Institute of Aboriginal Health, Tzu Chi University, Hualien County, Taiwan
XX
DR   MD5; cc365c3bd14fe53accee9defc9a071d6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-DPB1"
FT   mRNA            <11..>274
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT   CDS             <11..>274
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:A8I207"
FT                   /db_xref="IMGT/HLA:DPB1*41:01:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A8I207"
FT                   /protein_id="ABV72580.1"
FT                   /translation="NYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEEYWNSQKDFLEEERAVPDRMCRHNYELGGPMTLQRR"
FT   exon            11..274
FT                   /gene="HLA-DPB1"
FT                   /number=2
XX
SQ   Sequence 276 BP; 61 A; 69 C; 101 G; 45 T; 0 other;
     ctccccgcag agaattacct tttccaggga cggcaggaat gctacgcgtt taatgggaca        60
     cagcgcttcc tggagagata catctacaac cgggaggagt tcgtgcgctt cgacagcgac       120
     gtgggggagt tccgggcggt gacggagctg gggcggcctg atgaggagta ctggaacagc       180
     cagaaggact tcctggagga ggagcgggca gtgccggata ggatgtgcag acacaactac       240
     gagctgggcg ggcccatgac cctgcagcgc cgaggt                                 276
//


spacer
spacer