spacer

EBI Dbfetch

ID   EU146150; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EU146150;
XX
DT   02-OCT-2007 (Rel. 93, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*150201 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   "Novel HLA class II allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   ;
RL   Submitted (10-SEP-2007) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; 4b23d3b0a45c54314cbdc7e70b842a1d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /isolate="BY00256"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*150201 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*150201 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*150201 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:A8D9Z3"
FT                   /db_xref="IMGT/HLA:DRB1*15:27"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A8D9Z3"
FT                   /protein_id="ABV66221.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*150201 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 55 A; 66 C; 101 G; 48 T; 0 other;
     cacgtttcct gtggcagcct aagagggagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer