Dbfetch

ID   EU140343; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   EU140343;
XX
DT   26-SEP-2007 (Rel. 93, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*6601N allele, exon 3
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RX   PUBMED; 23137326.
RA   Dongmei W., Li W., Wang L., Ni L., Zhixin Z.;
RT   "A novel HLA-A*66 allele, A*66:07";
RL   Tissue Antigens 80(6):542-543(2012).
XX
RN   [2]
RP   1-276
RA   Liu N., Li W., Wang L., He X., Wang Z., Cui S., Wang L., Ni L., Gong Z.,
RA   Zhao B., Zhang Z., Shan X.;
RT   "Identification of a novel HLA-A allele HLA-A*6601N in Chinese Bone Marrow
RT   Donor";
RL   Unpublished.
XX
RN   [3]
RP   1-276
RA   Liu N., Li W., Wang L., He X., Wang Z., Cui S., Wang L., Ni L., Gong Z.,
RA   Zhao B., Zhang Z., Shan X.;
RT   ;
RL   Submitted (05-SEP-2007) to the INSDC.
RL   HLA Laboratory, Beijing Red Cross Blood Center, 37 Beisanhuan Zhonglu,
RL   Beijing 100088, China
XX
DR   MD5; 49debeb4def2cf204a7dc33f97e90f0e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6601N"
FT   mRNA            <1..>276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6601N"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6601N"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A8D714"
FT                   /db_xref="IMGT/HLA:A*66:07"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A8D714"
FT                   /protein_id="ABV53970.1"
FT                   /translation="SHTIQRMYGCDVGPDGRFLRGYQQDAYDGKDYIALNEDLRSWTAA
FT                   DMAAQITQRKWETAHEAEQWRAYLEGRCAEWLRRYLENGKETLQRT"
FT   exon            1..276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6601N"
FT                   /number=3
FT   variation       223
FT                   /gene="HLA-A"
FT                   /replace="t"
XX
SQ   Sequence 276 BP; 56 A; 80 C; 103 G; 37 T; 0 other;
     gttctcacac catccagagg atgtatggct gcgacgtggg gccggacggg cgcttcctcc        60
     gcgggtacca gcaggacgct tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcttggac cgcggcggac atggcggctc agatcaccca gcgcaagtgg gagacggccc       180
     atgaggcgga gcagtggaga gcctacctgg agggccggtg cgcggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcacgg                                 276
//