spacer

EBI Dbfetch

ID   EU131777; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EU131777;
XX
DT   23-SEP-2007 (Rel. 93, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*07 allele, exon
DE   2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Balas A., Garcia-Sanchez F., Vicario J.L.;
RT   "Sequencing of a new DRB1*07 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Balas A., Garcia-Sanchez F., Vicario J.L.;
RT   ;
RL   Submitted (04-SEP-2007) to the INSDC.
RL   Histocompatibility, CTM, Avenida de la Democracia, Madrid 28032, Spain
XX
DR   MD5; e991c16bcfa4ae9e2d4320aa61eaca46.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*07"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*07"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*07"
FT                   /product="MHC class II antigen"
FT                   /note="histocompatibility antigen"
FT                   /db_xref="GOA:A8D305"
FT                   /db_xref="IMGT/HLA:DRB1*07:15"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A8D305"
FT                   /protein_id="ABV44415.1"
FT                   /translation="RFLWQGKYKCHFFNGKERVQFLERLFYNQEEFVRFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDILEDRRGQVDTVCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*07"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 62 C; 100 G; 49 T; 0 other;
     cacgtttcct gtggcagggt aagtataagt gtcatttctt caacgggaag gagcgggtgc        60
     agttcctgga aagactcttc tataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctagggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacatcct ggaggacagg cggggccagg tggacaccgt gtgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer