spacer

EBI Dbfetch

ID   EU131141; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   EU131141;
XX
DT   29-OCT-2007 (Rel. 93, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*072N allele, exon 3
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Wang L., He X., Li W., Wang Z., Liu N., Ni L., Cui S., Wang L., Zhao B.,
RA   Gong Z., Zhang Z., Shan X.;
RT   "Identification of a novel HLA-B allele HLA-B*0724N in Chinese bone marrow
RT   donor";
RL   Unpublished.
XX
RN   [2]
RP   1-276
RA   Wang L., He X., Li W., Wang Z., Liu N., Ni L., Cui S., Wang L., Zhao B.,
RA   Gong Z., Zhang Z., Shan X.;
RT   ;
RL   Submitted (03-SEP-2007) to the INSDC.
RL   HLA Laboratory, Beijing Red Cross Blood Center, No.37 Beisanhuan Zhonglu,
RL   Beijing 100088, China
XX
DR   MD5; d4acfc44344786ec29e53d22d046c562.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*072N"
FT   mRNA            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*072N"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*072N"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A8UHA5"
FT                   /db_xref="IMGT/HLA:B*07:60"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A8UHA5"
FT                   /protein_id="ABW22746.1"
FT                   /translation="SHTLQSMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAA
FT                   DTAAQITQRKWEAAREAEQRRAYLEGLCVEWLRRYLENGKETLQRA"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*072N"
FT                   /number=3
FT   variation       260
FT                   /gene="HLA-B"
FT                   /replace="c"
FT   variation       262
FT                   /gene="HLA-B"
FT                   /replace="a"
FT   variation       275
FT                   /gene="HLA-B"
FT                   /replace="t"
XX
SQ   Sequence 276 BP; 52 A; 88 C; 103 G; 33 T; 0 other;
     ggtctcacac cctccagagc atgtacggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggcatga ccagtacgcc tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcagcggaga gcctacctgg agggcctgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer