Dbfetch

ID   EU111805; SV 1; linear; genomic DNA; STD; HUM; 1900 BP.
XX
AC   EU111805;
XX
DT   11-SEP-2007 (Rel. 93, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*31 allele, exons 1
DE   through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1900
RA   Chang Y., Pascual C.J., Alonzo P.;
RT   "Identification of a New HLA-A*31 Allele";
RL   Unpublished.
XX
RN   [2]
RP   1-1900
RA   Chang Y., Pascual C.J., Alonzo P.;
RT   ;
RL   Submitted (21-AUG-2007) to the INSDC.
RL   Pathology & Laboratory Medicine, All Children's Hospital, 801 6th St.
RL   South, St. Petersburg, FL 33701, USA
XX
DR   MD5; 03b9c030a70ca36e4336bf0e722ee386.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1900
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1845
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT   mRNA            join(<1..52,183..452,694..969,1570..>1845)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..52,183..452,694..969,1570..>1845)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /product="MHC class I antigen"
FT                   /note="HLA-A antigen"
FT                   /db_xref="GOA:A7Y1U3"
FT                   /db_xref="IMGT/HLA:A*31:20"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A7Y1U3"
FT                   /protein_id="ABU96767.1"
FT                   /translation="TLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPRFIAVGYV
FT                   DDTQFVRFDSDAASQRMEPRAPWIEQERPEYWDQETRNVKAHSQIDRVDLGTLRGYYNQ
FT                   SEAGAHTIQMMYGCDVGSDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRK
FT                   WEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDPPKTHMTHHAVSDHEATLRCWA
FT                   LSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRYTCHVQHE
FT                   GLPKPLTLRW"
FT   exon            <1..52
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=1
FT   exon            183..452
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=2
FT   exon            694..969
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=3
FT   exon            1570..>1845
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=4
XX
SQ   Sequence 1900 BP; 362 A; 577 C; 619 G; 342 T; 0 other;
     accctcctcc tgctactctt gggggccctg gccctgaccc agacctgggc gggtgagtgc        60
     ggggtcggtg gggaaaccgc ctctgcgggg agaagcaagg ggcccgcccg gcgggggcgc       120
     aggacccggg tagccgcgcc gggaggaggg tcgggcggat ctcagccact cctcgccccc       180
     aggctcccac tccatgaggt atttcaccac atccgtgtcc cggcccggcc gcggggagcc       240
     ccgcttcatc gccgtgggct acgtggacga cacgcagttc gtgcggttcg acagcgacgc       300
     cgcgagccag aggatggagc cgcgggcgcc gtggatagag caggagaggc ctgagtattg       360
     ggaccaggag acacggaatg tgaaggccca ctcacagatt gaccgagtgg acctggggac       420
     cctgcgcggc tactacaacc agagcgaggc cggtgagtga ccccagcccg gggcgcaggt       480
     cacgacctct catcccccac ggacgggcca ggtcacccac agtctccggg tccgagatcc       540
     accccgaagc cgcgggaccc cgagaccctt gccccgggag aggcccaggc gcctttaccc       600
     ggtttcattt tcagtttagg ccaaaaatcc ccccgggttg gtcggggccg gacggggctc       660
     gggggactgg gctgaccgtg gggtcggggc caggtgctca caccatccag atgatgtatg       720
     gctgcgacgt ggggtcggac gggcgcttcc tccgcgggta ccagcaggac gcctacgacg       780
     gcaaggatta catcgccttg aacgaggacc tgcgctcttg gaccgcggcg gacatggcgg       840
     ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagttg agagcctacc       900
     tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag gagacgctgc       960
     agcgcacggg taccaggggc cacggggcgc ctccctgatc gcctgtagat ctcccgggct      1020
     ggcctcccac aaggagggga gacaattggg accaacacta gaatatcacc ctccctctgg      1080
     tcctgaggga gaggaatcct cctgggtttc cagatcctgt accagagagt gactctgagg      1140
     ttccgccctg ctctgtgaca caattaaggg ataaaatctc tgaaggaatg acgggaagac      1200
     gatccctcga atactgatga gtggttccct ttgacacaca ccggcagcag ccttgggccc      1260
     gtgacttttc ctctcaggcc ttgttctctg cttcacactc aatgtgtgtg ggggtctgag      1320
     tccagcactt ctgagtccct cagcctccac tcaggtcagg accagaagtc gctgttccct      1380
     cttcagggac tagaattttc cacggaatag gagattatcc caggtgcctg tgtccaggct      1440
     ggtgtctggg ttctgtgctc ccttccccat cccaggtgtc ctgtccattc tcaagatagc      1500
     cacatgtgtg ctggaggagt gtcccattac agatgcaaaa tgcctgaatg ttctgactct      1560
     tcctgacaga cccccccaag acgcatatga ctcaccacgc tgtctctgac catgaggcca      1620
     ccctgaggtg ctgggccctg agcttctacc ctgcggagat cacactgacc tggcagcggg      1680
     atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca ggggatggaa      1740
     ccttccagaa gtgggcgtct gtggtggtgc cttctggaca ggagcagaga tacacctgcc      1800
     atgtgcagca tgagggtctc cccaagcccc tcaccctgag atggggtaag gagggagatg      1860
     ggggtgtcat gtcttttagg gaaagcagga gcctctctga                            1900
//