spacer

EBI Dbfetch

ID   EU099586; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   EU099586;
XX
DT   14-NOV-2007 (Rel. 93, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens isolate chengshaohua MHC class I antigen (HLA-B) gene,
DE   HLA-B*15new allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Shan X., Li W., Liu N., Ni L., Wang L., Wang L., Cui S., Wang Z., He X.,
RA   Gong Z., Zhao B., Zhang Z.;
RT   "Identified a Novel Allele by Sequence-Based Typing";
RL   Unpublished.
XX
RN   [2]
RP   1-276
RA   Shan X., Li W., Liu N., Ni L., Wang L., Wang L., Cui S., Wang Z., He X.,
RA   Gong Z., Zhao B., Zhang Z.;
RT   ;
RL   Submitted (15-AUG-2007) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No. 37 North Third Ring Road,
RL   Beijing 100088, China
XX
DR   MD5; b8b753e42bd474cdc32ee8b3e7b9182e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="chengshaohua"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15new"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A8U3X0"
FT                   /db_xref="IMGT/HLA:B*15:137"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A8U3X0"
FT                   /protein_id="ABW97435.1"
FT                   /translation="SHTWQTMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLSSWTAA
FT                   DTAAQITQRKWEAAREAEQWRAYLEGLCVEWLRRYLENGKETLQRA"
FT   misc_difference 36
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15new"
FT                   /replace="g"
FT                   /note="compared to HLA-B*1504"
FT   misc_difference 66
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15new"
FT                   /replace="c"
FT                   /note="compared to HLA-B*1504"
FT   misc_difference 69
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15new"
FT                   /replace="g"
FT                   /note="compared to HLA-B*1504"
FT   misc_difference 76
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15new"
FT                   /replace="c"
FT                   /note="compared to HLA-B*1504"
XX
SQ   Sequence 276 BP; 53 A; 81 C; 104 G; 38 T; 0 other;
     ggtctcacac ttggcagacg atgtatggct gcgacctggg gccggacggg cgcctcctcc        60
     gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaac gaggacctga       120
     gctcctggac cgcggcggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcagtggaga gcctacctgg agggcctgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer