spacer

EBI Dbfetch

ID   EU091341; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   EU091341;
XX
DT   15-SEP-2007 (Rel. 93, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*1540novel allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Cui S., Shan X., He X., Liu N., Wang L., Li W., Wang L., Ni L., Wang Z.,
RA   Zhao B., Gong Z.;
RT   "Identified a novel allele by sequence-based typing";
RL   Unpublished.
XX
RN   [2]
RP   1-276
RA   Cui S., Shan X., He X., Liu N., Wang L., Li W., Wang L., Ni L., Wang Z.,
RA   Zhao B., Gong Z., Zhang Z.;
RT   ;
RL   Submitted (12-AUG-2007) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No 37 North Third Ring Road,
RL   Beijing 100088, China
XX
DR   MD5; 5c30547f79fbe40fcadbc5cc2d72f26c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1540novel"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1540novel"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A7XPU1"
FT                   /db_xref="IMGT/HLA:B*15:138"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A7XPU1"
FT                   /protein_id="ABU94839.1"
FT                   /translation="SHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAA
FT                   DTAAQITQRKWEAAREAEQLRAYLEGECVEWLRRYLENGKDKLERA"
FT   variation       260
FT                   /gene="HLA-B"
FT                   /replace="g"
FT                   /note="results in aspartic acid to glutamic acid
FT                   substitution as compared to HLA-B*1540"
FT   variation       262
FT                   /gene="HLA-B"
FT                   /replace="c"
FT                   /note="results in lysine to threonine substitution as
FT                   compared to HLA-B*1540"
FT   variation       267
FT                   /gene="HLA-B"
FT                   /replace="c"
FT                   /note="results in glutamic acid to glutamine substitution
FT                   as compared to HLA-B*1540"
FT   variation       275
FT                   /gene="HLA-B"
FT                   /replace="g"
FT                   /note="silent substitution as compared to HLA-B*1540"
XX
SQ   Sequence 276 BP; 54 A; 84 C; 104 G; 34 T; 0 other;
     ggtctcacac cctccagagg atgtacggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggcatga ccagtccgcc tacgacggca aggattacat cgccctgaac gaggacctga       120
     gctcctggac cgcggcggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggac aagctggagc gcgctg                                 276
//


spacer
spacer