spacer

EBI Dbfetch

ID   EU090251; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EU090251;
XX
DT   15-SEP-2007 (Rel. 93, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*116502 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2008.01029.x.
RX   PUBMED; 18331522.
RA   Serov Y., Hommel-Berrey G., Lobashevsky A.;
RT   "Identification of a novel HLA-DRB1 allele, DRB1*116502, by sequence-based
RT   typing in an African-American individual";
RL   Tissue Antigens 71(5):489-490(2008).
XX
RN   [2]
RP   1-270
RA   Serov Y.A., Hommel-Berrey G.A., Lobashevsky A.;
RT   ;
RL   Submitted (09-AUG-2007) to the INSDC.
RL   Medicine, Indiana University (IUPUI), 702 Barnhill Dr 0715, Indianapolis,
RL   IN 46112, USA
XX
DR   MD5; 9d2e240c1d1999f762cab3b97de3c6d5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /clone="MMarsh1"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*116502"
FT                   /note="HWS100004947"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*116502"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:A7XPK7"
FT                   /db_xref="IMGT/HLA:DRB1*11:65:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A7XPK7"
FT                   /protein_id="ABV03594.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEDYWNSQKDILEDERAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*116502"
FT                   /number=2
FT   variation       164
FT                   /gene="HLA-DRB1"
FT                   /replace="g"
FT                   /note="results in glutamine to asparagine substitution"
FT   variation       264
FT                   /gene="HLA-DRB1"
FT                   /replace="c"
XX
SQ   Sequence 270 BP; 60 A; 62 C; 96 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggactactgg aacagccaga       180
     aggacatcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagaggcgag                                        270
//


spacer
spacer