spacer

EBI Dbfetch

ID   EU088012; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EU088012;
XX
DT   01-OCT-2007 (Rel. 93, Created)
DT   28-OCT-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*12 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2009.01340.x.
RX   PUBMED; 19737371.
RA   Ji Y., Sun Y., Xie J.H., Yang J.H., Liu Y., Du K.M.;
RT   "A novel HLA-DRB1*120204 allele found in a Chinese individual";
RL   Tissue Antigens 74(5):462-463(2009).
XX
RN   [2]
RP   1-270
RA   Ji Y., Sun Y., Fu M., Jin Y., Xie J., Yang J., Zhang Z., Mao Z., Fan L.,
RA   Liu D., Qian K., Du K.;
RT   "Identified a novel allele by sequence-based typing";
RL   Unpublished.
XX
RN   [3]
RP   1-270
RA   Ji Y., Sun Y., Fu M., Jin Y., Xie J., Yang J., Zhang Z., Mao Z., Fan L.,
RA   Liu D., Qian K., Du K.;
RT   ;
RL   Submitted (08-AUG-2007) to the INSDC.
RL   Immunogenetics Lab, Shang Hai Blood Center, No. 1191 Hong-Qiao Rd, Shanghai
RL   200051, China
XX
DR   MD5; d306d8748e2d5cd02072e9d8d3d7f060.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:A8CKH4"
FT                   /db_xref="IMGT/HLA:DRB1*12:02:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A8CKH4"
FT                   /protein_id="ABV49612.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRLLERHFHNQEELLRFDSDVGEFRAV
FT                   TELGRPVAESWNSQKDFLEDRRAAVDTYCRHNYGAVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12 variant"
FT                   /number=2
FT   variation       203
FT                   /gene="HLA-DRB1"
FT                   /replace="c"
FT                   /note="synonomous substitution"
XX
SQ   Sequence 270 BP; 54 A; 66 C; 99 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttactgga gagacacttc cataaccagg aggagctcct gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacttcct ggaagacagg cgggccgcgg tggacaccta ttgcagacac aactacgggg       240
     ctgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer