spacer

EBI Dbfetch

ID   EU079376; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EU079376;
XX
DT   11-SEP-2007 (Rel. 93, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*08032new
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   PUBMED; 23066672.
RA   Wang D., Li W., Wang L., Xiaoyan S., Zhixin Z.;
RT   "Two new alleles, HLA-DRB1*11:64 and HLA-DRB1*04:67 identified in Chinese
RT   individuals";
RL   Tissue Antigens 80(6):553-554(2012).
XX
RN   [2]
RP   1-270
RA   Li W., Shan X., Liu N., Ni L., Wang L., Wang L., Cui S., Wang Z., He X.,
RA   Gong Z., Zhao B., Zhang Z.;
RT   "Identification of a novel allele by sequence-based typing";
RL   Unpublished.
XX
RN   [3]
RP   1-270
RA   Li W., Shan X., Liu N., Ni L., Wang L., Wang L., Cui S., Wang Z., He X.,
RA   Gong Z., Zhao B., Zhang Z.;
RT   ;
RL   Submitted (03-AUG-2007) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No. 37 North Third Ring Road,
RL   Beijing 100088, China
XX
DR   MD5; bd3e1e47720682ca42af1b3bdb3d6369.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*08032new"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*08032new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*08032new"
FT                   /product="MHC class II antigen"
FT                   /note="leukocyte antigen"
FT                   /db_xref="GOA:A7XFV9"
FT                   /db_xref="IMGT/HLA:DRB1*08:33"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A7XFV9"
FT                   /protein_id="ABU96079.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYWAV
FT                   TELGRPSAEYWNSQKDILEDRRALVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*08032new"
FT                   /number=2
FT   variation       129
FT                   /gene="HLA-DRB1"
FT                   /replace="c"
FT                   /note="results in Trp to Arg substitution; compared to
FT                   HLA-DRB1*080302"
XX
SQ   Sequence 270 BP; 59 A; 62 C; 97 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtactg ggcggtgacg gagctggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacagg cgggccctgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer