spacer

EBI Dbfetch

ID   EU079372; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EU079372;
XX
DT   11-SEP-2007 (Rel. 93, Created)
DT   01-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*1502new allele, exon 2
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/tan.12152.
RX   PUBMED; 23849074.
RA   Zhang W.D., Wang L.J., Zhang K.Y., Shan X.Y., Jia Y.J.;
RT   "Characterization of a novel allele, HLA-B*15:139";
RL   Tissue Antigens 82(2):145-146(2013).
XX
RN   [2]
RP   1-270
RA   Wang L., Shan X., Wang L., Cui S., Wang Z., Ni L., He X., Liu N., Li W.,
RA   Zhao B., Gong Z., Zhang Z.;
RT   "Identification of a novel allele by sequence-based typing";
RL   Unpublished.
XX
RN   [3]
RP   1-270
RA   Wang L., Shan X., Wang L., Cui S., Wang Z., Ni L., He X., Liu N., Li W.,
RA   Zhao B., Gong Z., Zhang Z.;
RT   ;
RL   Submitted (03-AUG-2007) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No 37 North Third Ring Road,
RL   Beijing, Beijing 100088, China
XX
DR   MD5; c88045645432e580a5bc27c9ad2b281a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1502new"
FT   mRNA            <1..>270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1502new"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1502new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A7XFV8"
FT                   /db_xref="IMGT/HLA:B*15:139"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:A7XFV8"
FT                   /protein_id="ABU96080.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRNTQISKANTQTYRESLRNLRGYYNQSEA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1502new"
FT                   /number=2
FT   variation       204
FT                   /gene="HLA-B"
FT                   /replace="a"
FT                   /note="results Ala to Thr substitution; compared to
FT                   HLA-B*1502"
XX
SQ   Sequence 270 BP; 58 A; 89 C; 87 G; 36 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctcc aaggccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer