spacer

EBI Dbfetch

ID   EU071686; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EU071686;
XX
DT   12-AUG-2007 (Rel. 92, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*100101 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   "Novel HLA Class II allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   ;
RL   Submitted (26-JUL-2007) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd. N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; bc7f41948d75899cbfe86ebc36674911.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*100101 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*100101 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*100101 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:A7UHG4"
FT                   /db_xref="IMGT/HLA:DRB1*10:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A7UHG4"
FT                   /protein_id="ABS87345.1"
FT                   /translation="RFLEEVKFECHFFNGTERVRLLERRVHNQEEYARYDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLERRRAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*100101 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 63 C; 103 G; 46 T; 0 other;
     cacgtttctt ggaggaggtt aagtttgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttgctgga aagacgcgtc cataaccaag aggagtacgc gcgctacgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcggagg cgtgccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer