Dbfetch

ID   EU056568; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   EU056568;
XX
DT   21-DEC-2007 (Rel. 94, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*35new allele, exons 2,
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RX   PUBMED; 17999652.
RA   Aureli A., Liberatore G., Papola F., Adorno D., Piancatelli D.;
RT   "Identification of a novel HLA-B allele, HLA-B*3580, with possible
RT   implication in transplantation and CTL response";
RL   Tissue Antigens 71:90-91(2007).
XX
RN   [2]
RP   1-791
RA   Aureli A., Piancatelli D., Liberatore G., Del Beato T., Papola F.,
RA   Azzarone R., Adorno D.;
RT   ;
RL   Submitted (25-JUL-2007) to the INSDC.
RL   CNR, Institute for Organ Transplantation and Immunocytology, Piazzale
RL   Collemaggio, L'Aquila 67100, Italy
XX
DR   MD5; 49db691efe26f1b642e47811e1080601.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="F866"
FT                   /mol_type="genomic DNA"
FT                   /country="Italy"
FT                   /isolation_source="potential bone marrow recipient"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35new"
FT   mRNA            join(<1..270,516..>791)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*35:80"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:A9Y367"
FT                   /protein_id="ABW23079.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRETQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQRRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35new"
FT                   /number=2
FT   gap             271..515
FT                   /estimated_length=245
FT   exon            516..791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35new"
FT                   /number=3
FT   variation       711
FT                   /gene="HLA-B"
FT                   /replace="t"
FT                   /note="compared to HLA-B*3510"
XX
SQ   Sequence 791 BP; 111 A; 173 C; 190 G; 72 T; 245 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatcttc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnggtct cacatcatcc agaggatgta       540
     tggctgcgac ctggggcccg acgggcgcct cctccgcggg catgaccagt ccgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg cggacaccgc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgtg gcggagcagc ggagagccta       720
     cctggagggc ctgtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct       780
     gcagcgcgcg g                                                            791
//