Dbfetch

ID   EU048339; SV 1; linear; mRNA; STD; HUM; 276 BP.
XX
AC   EU048339;
XX
DT   02-AUG-2008 (Rel. 96, Created)
DT   02-AUG-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) mRNA, HLA-B*81novel allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Zhang D., Wan Y.;
RT   "A novel allele HLA-B*81 identified by SBT";
RL   Unpublished.
XX
RN   [2]
RP   1-276
RA   Zhang D., Wan Y.;
RT   ;
RL   Submitted (23-JUL-2007) to the INSDC.
RL   HLA Lab, Taiyuan Red Cross Blood Center, 185 Taiyuan Yingze West Street,
RL   Taiyuan, Shanxi 030024, China
XX
DR   MD5; dfff61cba5ef2a9f2ab0809f649678ff.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*81novel"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*81novel"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*81:03"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B4XKD1"
FT                   /protein_id="ABW16863.1"
FT                   /translation="PPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDT
FT                   ELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
XX
SQ   Sequence 276 BP; 67 A; 84 C; 83 G; 42 T; 0 other;
     accccccaaa gacacacgtg acccaccacc ccgtctctga ccatgaggcc accctgaggt        60
     gctgggccct gggcttctac cctgcggaga tcacactgac ctggcagcgg gatggcgagg       120
     accaaactca ggacactgag cttgtggaga ccagaccagc aggagataga accttccaga       180
     agtgggcagc tgtggtggtg ccttctggag aagagcagag atacacatgc catgtacagc       240
     atgaggggct gccgaagccc ctcaccctga gatggg                                 276
//