spacer

EBI Dbfetch

ID   EU029779; SV 1; linear; genomic DNA; STD; HUM; 787 BP.
XX
AC   EU029779;
XX
DT   10-SEP-2007 (Rel. 93, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens isolate BY00197 MHC class I antigen (HLA-A) gene, HLA-A*240201
DE   allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-787
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   "Novel HLA class I allele";
RL   Unpublished.
XX
RN   [2]
RP   1-787
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   ;
RL   Submitted (11-JUL-2007) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd NW, DC 20057, USA
XX
DR   MD5; cb7a68b1de4b15187936b504fc711efe.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..787
FT                   /organism="Homo sapiens"
FT                   /isolate="BY00197"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA typing information: A*1101/1104/1119/1121N/1127,
FT                   *240201variant, B*07EH *4006 DRB1*1502, *15ANVF"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*240201"
FT   mRNA            join(<1..270,512..>787)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*240201"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..>787)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*240201"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A7X567"
FT                   /db_xref="IMGT/HLA:A*24:82"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A7X567"
FT                   /protein_id="ABU86838.1"
FT                   /translation="SHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTC
FT                   VDGLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*240201"
FT                   /number=2
FT   gap             271..511
FT                   /estimated_length=241
FT   exon            512..787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*240201"
FT                   /number=3
XX
SQ   Sequence 787 BP; 112 A; 165 C; 194 G; 75 T; 241 other;
     gctcccactc catgaggtat ttcaccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acgaggagac agggaaagtg aaggcccact cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngttctcaca ccctccagat gatgtttggc       540
     tgcgacgtgg ggtcggacgg gcgcttcctc cgcgggtacc accagtacgc ctacgacggc       600
     aaggattaca tcgccctgaa agaggacctg cgctcttgga ccgcggcgga catggcggct       660
     cagatcacca agcgcaagtg ggaggcggcc catgtggcgg agcagcagag agcctacctg       720
     gagggcacgt gcgtggacgg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacgg                                                                 787
//


spacer
spacer