spacer

EBI Dbfetch

ID   EU029777; SV 1; linear; genomic DNA; STD; HUM; 786 BP.
XX
AC   EU029777;
XX
DT   10-SEP-2007 (Rel. 93, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens isolate BY00199 MHC class I antigen (HLA-A) gene, HLA-A*0211
DE   allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-786
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   "Novel HLA class I allele";
RL   Unpublished.
XX
RN   [2]
RP   1-786
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   ;
RL   Submitted (11-JUL-2007) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd NW, DC 20057, USA
XX
DR   MD5; 8ba4923755904f9b5262cdaf0bfb3927.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..786
FT                   /organism="Homo sapiens"
FT                   /isolate="BY00199"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>786
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0211"
FT   mRNA            join(<1..270,512..>786)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0211"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..>786)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0211"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A7X555"
FT                   /db_xref="IMGT/HLA:A*02:128"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A7X555"
FT                   /protein_id="ABU86836.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRNVKAHSQIDRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGS
FT                   DWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0211"
FT                   /number=2
FT   gap             271..511
FT                   /estimated_length=241
FT   exon            512..786
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0211"
FT                   /number=3
XX
SQ   Sequence 786 BP; 110 A; 159 C; 194 G; 82 T; 241 other;
     gctctcactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagggtccg gagtattggg       180
     acggggagac acggaatgtg aaggcccact cacagattga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngttctcaca ccgtccagag gatgtatggc       540
     tgcgacgtgg ggtcggactg gcgcttcctc cgcgggtacc accagtacgc ctacgacggc       600
     aaggattaca tcgccctgaa agaggacctg cgctcttgga ccgcggcgga catggcagct       660
     cagaccacca agcacaagtg ggaggcggcc catgtggcgg agcagttgag agcctacctg       720
     gagggcacgt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacg                                                                  786
//


spacer
spacer