spacer

EBI Dbfetch

ID   EU029771; SV 1; linear; genomic DNA; STD; HUM; 786 BP.
XX
AC   EU029771;
XX
DT   10-SEP-2007 (Rel. 93, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens isolate BY00202 MHC class I antigen (HLA-A) gene, HLA-A*0115N
DE   allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-786
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   "Novel HLA class I allele";
RL   Unpublished.
XX
RN   [2]
RP   1-786
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   ;
RL   Submitted (11-JUL-2007) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd NW, DC 20057, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..786
FT                   /organism="Homo sapiens"
FT                   /isolate="BY00202"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>786
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0115N"
FT   mRNA            join(<1..270,512..>786)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0115N"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..>786)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0115N"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A7X516"
FT                   /db_xref="IMGT/HLA:A*01:15N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A7X516"
FT                   /protein_id="ABU86830.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKME
FT                   PRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGP
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGGA
FT                   WTGSADTWRTGRRRCSAR"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0115N"
FT                   /number=2
FT   gap             271..511
FT                   /estimated_length=241
FT   exon            512..786
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0115N"
FT                   /number=3
XX
SQ   Sequence 786 BP; 112 A; 163 C; 195 G; 75 T; 241 other;
     gctcccactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagaa gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatatg aaggcccact cacagactga ccgagcgaac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngttctcaca ccatccagat aatgtatggc       540
     tgcgacgtgg ggccggacgg gcgcttcctc cgcgggtacc ggcaggacgc ctacgacggc       600
     aaggattaca tcgccctgaa cgaggacctg cgctcttgga ccgcggcgga catggcagct       660
     cagatcacca agcgcaagtg ggaggcggtc catgcggcgg agcagcggag agtctacctg       720
     gagggcggtg cgtggacggg ctccgcagat acctggagaa cgggaaggag acgctgcagc       780
     gcacgg                                                                  786
//


spacer
spacer