Dbfetch

ID   EU022558; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   EU022558;
XX
DT   17-AUG-2007 (Rel. 92, Created)
DT   01-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*4801 variant allele,
DE   exon 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RX   DOI; 10.1111/tan.12166.
RX   PUBMED; 24032730.
RA   Zhang W.D., Li W., Zhang K.Y., Shan X.Y., Jia Y.J.;
RT   "The novel HLA-B*48:19 allele, identified by sequence-based typing in a
RT   Chinese individual";
RL   Tissue Antigens 82(3):209-210(2013).
XX
RN   [2]
RP   1-276
RA   Li W., Shan X., Liu N., Ni L., Wang L., Wang L., Cui S., Wang Z., He X.,
RA   Gong Z., Zhao B., Zhang Z.;
RT   "A novel allele identified by sequence-based typing";
RL   Unpublished.
XX
RN   [3]
RP   1-276
RA   Li W., Shan X., Liu N., Ni L., Wang L., Wang L., Cui S., Wang Z., He X.,
RA   Gong Z., Zhao B., Zhang Z.;
RT   ;
RL   Submitted (08-JUL-2007) to the INSDC.
RL   HLA Lab, No. 37 North Ring Road, Beijing 100088, China
XX
DR   MD5; ba4c330e227564ae8ad787955d88ba05.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4801 variant"
FT   mRNA            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4801 variant"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4801 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A7U8S4"
FT                   /db_xref="IMGT/HLA:B*48:19"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A7U8S4"
FT                   /protein_id="ABS89175.1"
FT                   /translation="SHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAA
FT                   DTAAQISQRKLEAARVAEQWRAYLEGECVEWLRRYLENGKDKLERA"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4801 variant"
FT                   /number=3
FT   variation       195..196
FT                   /gene="HLA-B"
FT                   /replace="ct"
FT                   /note="results in tryptophan to leucine substitution; as
FT                   compared to HLA-B*4801"
XX
SQ   Sequence 276 BP; 53 A; 85 C; 101 G; 37 T; 0 other;
     ggtctcacac cctccagagc atgtacggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggcataa ccagtacgcc tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcctggac cgccgcggac acggcggctc agatctccca gcgcaagttg gaggcggccc       180
     gtgtggcgga gcagtggaga gcctacctgg agggcgagtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggac aagctggagc gcgctg                                 276
//