spacer

EBI Dbfetch

ID   EU022523; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   EU022523;
XX
DT   17-AUG-2007 (Rel. 92, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*1518variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Wang L., Shan X., Gao Q., Cui S., Wang Z., Ni L., He X., Liu N., Li W.,
RA   Zhao B., Gong Z., Zhang Z.;
RT   "A novel allele identified by sequence-based typing";
RL   Unpublished.
XX
RN   [2]
RP   1-276
RA   Wang L., Shan X., Gao Q., Cui S., Wang Z., Ni L., He X., Liu N., Li W.,
RA   Zhao B., Gong Z., Zhang Z.;
RT   ;
RL   Submitted (08-JUL-2007) to the INSDC.
RL   HLA Lab, No. 37 North Ring Road, Beijing 100088, China
XX
DR   MD5; 4e255a51baee4fbd900f45dfab9d5e00.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1518variant"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1518variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A7U8S2"
FT                   /db_xref="IMGT/HLA:B*15:133"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A7U8S2"
FT                   /protein_id="ABS86028.1"
FT                   /translation="SHTLQRMYGCDVGPDGRLLRGHDQFAYDGKDYIALNEDLSSWTAA
FT                   DTAAQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLENGKETLQRA"
FT   variation       76
FT                   /gene="HLA-B"
FT                   /replace="c"
FT                   /note="results in phenylalanine to serine substitution;
FT                   compared to HLA-B*1518"
XX
SQ   Sequence 276 BP; 52 A; 85 C; 104 G; 35 T; 0 other;
     ggtctcacac cctccagagg atgtacggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggcatga ccagttcgcc tacgacggca aggattacat cgccctgaac gaggacctga       120
     gctcctggac cgcggcggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer