spacer

EBI Dbfetch

ID   EU017384; SV 1; linear; genomic DNA; STD; HUM; 1657 BP.
XX
AC   EU017384;
XX
DT   01-AUG-2007 (Rel. 92, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*07new allele, exons
DE   2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1657
RX   DOI; 10.1111/j.1399-0039.2007.00981.x.
RX   PUBMED; 18069932.
RA   Thompson E.M., Kashi Z.M., Martin R.K., Alcorn J.L., Tidey L.;
RT   "Identification of the novel HLA-C allele Cw*0751";
RL   Tissue Antigens 71(2):178-179(2008).
XX
RN   [2]
RP   1-1657
RA   Thompson E.M., Mehdizadeh Kashi Z., Martin R.K., Alcorn J.L.;
RT   "Identification of a novel HLA-Cw allele with a sequence-based typing and
RT   cloning approach";
RL   Unpublished.
XX
RN   [3]
RP   1-1657
RA   Thompson E.M., Mehdizadeh Kashi Z., Martin R.K., Alcorn J.L.;
RT   ;
RL   Submitted (05-JUL-2007) to the INSDC.
RL   Kashi Clinical Laboratories, 8075 SW Nimbus Ave., Beaverton, OR 97008, USA
XX
DR   MD5; 985cda09552568171f585e5807c97cc0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1657
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1657
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT   mRNA            join(<1..270,520..795,1382..>1657)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,520..795,1382..>1657)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A7LH95"
FT                   /db_xref="IMGT/HLA:C*07:51"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A7LH95"
FT                   /protein_id="ABS56982.1"
FT                   /translation="SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEAGSHTLQRMSGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSW"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=2
FT   gap             271..519
FT                   /estimated_length=249
FT   exon            520..795
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=3
FT   gap             796..1381
FT                   /estimated_length=586
FT   exon            1382..1657
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=4
XX
SQ   Sequence 1657 BP; 167 A; 262 C; 284 G; 109 T; 835 other;
     gctcccactc catgaggtat ttcgacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnng gtctcacacc ctccagagga       540
     tgtctggctg cgacctgggg cccgacgggc gcctcctccg cgggtatgac cagtccgcct       600
     acgacggcaa ggattacatc gccctgaacg aggacctgcg ctcctggacc gccgcggaca       660
     ccgcggctca gatcacccag cgcaagttgg aggcggcccg tgcggcggag cagctgagag       720
     cctacctgga gggcacgtgc gtggagtggc tccgcagata cctggagaac gggaaggaga       780
     cgctgcagcg cgcagnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     naacccccaa agacacacgt gacccaccac cccctctctg accatgaggc caccctgagg      1440
     tgctgggccc tgggcttcta ccctgcggag atcacactga cctggcagcg ggatggggag      1500
     gaccagaccc aggacaccga gcttgtggag accaggccag caggagatgg aaccttccag      1560
     aagtgggcag ctgtggtggt gccttctgga caagagcaga gatacacgtg ccatatgcag      1620
     cacgaggggc tgcaagagcc cctcaccctg agctggg                               1657
//


spacer
spacer