spacer

EBI Dbfetch

ID   EF687782; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EF687782;
XX
DT   02-OCT-2007 (Rel. 93, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*0410 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Wang L., Shan X., Ni L., Wang Z., Wang L., Liu N., Li W., He X., Cui S.,
RA   Zhao B., Gong Z., Zhang Z.;
RT   "A novel HLA-DRB1*04 allele identified by sequence-based typing";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Wang L., Shan X., Ni L., Wang Z., Wang L., Liu N., Li W., He X., Cui S.,
RA   Zhao B., Gong Z., Zhang Z.;
RT   ;
RL   Submitted (19-JUN-2007) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No. 37 Beisanhuan Zhong Road,
RL   Beijing 100088, China
XX
DR   MD5; 4ee9d72298c7327127c123ee151437c3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0410"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0410"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0410"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:A8C5I7"
FT                   /db_xref="IMGT/HLA:DRB1*04:67"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A8C5I7"
FT                   /protein_id="ABV48914.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPSAEYWNSQKDLLEQKRAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0410"
FT                   /number=2
FT   variation       199
FT                   /gene="HLA-DRB1"
FT                   /replace="g"
FT                   /note="Arg71Lys"
XX
SQ   Sequence 270 BP; 60 A; 66 C; 97 G; 47 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer