Dbfetch

ID   EF687770; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   EF687770;
XX
DT   02-AUG-2008 (Rel. 96, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I (HLA-A) gene, HLA-A*020601 allele, exon 3 and
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RX   PUBMED; 23347090.
RA   Wang D., Liu N., Wang L., Li W., Zhang Z.;
RT   "Two new HLA alleles, HLA-A*23:20 and HLA-A*02:127 identified in Chinese
RT   individuals";
RL   Tissue Antigens 81(3):172-173(2013).
XX
RN   [2]
RP   1-276
RA   Wang Z., Shan X., Wang L., He X., Ni L., Cui S., Wang L., Li W., Liu N.,
RA   Zhao B., Gong Z., Zhang Z.;
RT   "A novel HLA-A*02 allele";
RL   Unpublished.
XX
RN   [3]
RP   1-276
RA   Wang Z., Shan X., Wang L., He X., Ni L., Cui S., Wang L., Li W., Liu N.,
RA   Zhao B., Gong Z., Zhang Z.;
RT   ;
RL   Submitted (19-JUN-2007) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No. 37 Beisanhuan Zhong Road,
RL   Beijing 100088, China
XX
DR   MD5; 0eedcc3758e7b37bb9c26b3789b43223.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020601"
FT   mRNA            <1..>276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020601"
FT                   /product="MHC class I"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020601"
FT                   /product="MHC class I"
FT                   /db_xref="GOA:B4XAM4"
FT                   /db_xref="IMGT/HLA:A*02:127"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B4XAM4"
FT                   /protein_id="ABV48912.1"
FT                   /translation="SHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAA
FT                   DMAAQTTKHKWEAAHVAEQLRAYLEGKCVEWLRRYLENGKETLQRT"
FT   exon            1..276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020601"
FT                   /number=3
FT   variation       217
FT                   /gene="HLA-A"
FT                   /replace="c"
FT                   /note="results in Thr to Lys substitution"
XX
SQ   Sequence 276 BP; 59 A; 78 C; 98 G; 41 T; 0 other;
     gttctcacac cgtccagagg atgtatggct gcgacgtggg gtcggactgg cgcttcctcc        60
     gcgggtacca ccagtacgcc tacgacggca aggattacat cgccctgaaa gaggacctgc       120
     gctcttggac cgcggcggac atggcagctc agaccaccaa gcacaagtgg gaggcggccc       180
     atgtggcgga gcagttgaga gcctacctgg agggcaagtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcacgg                                 276
//