spacer

EBI Dbfetch

ID   EF685282; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EF685282;
XX
DT   02-DEC-2007 (Rel. 94, Created)
DT   24-OCT-2013 (Rel. 118, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*02 variant allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   PUBMED; 23646951.
RA   Laaser I., Kolb H.J., Adamski J.;
RT   "A novel HLA-A*02 allele, HLA-A*02:129";
RL   Tissue Antigens 81(6):450-451(2013).
XX
RN   [2]
RP   1-270
RA   Laaser I., Kolb H.J., Adamski J.;
RT   "A Novel HLA-A*02 Allele Identified by Sequence-based Typing";
RL   Unpublished.
XX
RN   [3]
RP   1-270
RA   Laaser I., Kolb H.J., Adamski J.;
RT   ;
RL   Submitted (18-JUN-2007) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No.37 Beisanhuan Zhong Road,
RL   Beijing 100088, China
XX
DR   MD5; 0687cb998ab505757eb5783ca877a738.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02 variant"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A9Q9L1"
FT                   /db_xref="IMGT/HLA:A*02:129"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:A9Q9L1"
FT                   /protein_id="ABS58601.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEA"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02 variant"
FT                   /number=2
FT   variation       25
FT                   /gene="HLA-A"
FT                   /replace="t"
FT                   /note="compared to HLA-A*0287"
FT   variation       29
FT                   /gene="HLA-A"
FT                   /replace="a"
FT                   /note="compared to HLA-A*0287"
FT   variation       167
FT                   /gene="HLA-A"
FT                   /replace="t"
FT                   /note="compared to HLA-A*0287"
FT   variation       184
FT                   /gene="HLA-A"
FT                   /replace="g"
FT                   /note="compared to HLA-A*0287"
FT   variation       192
FT                   /gene="HLA-A"
FT                   /replace="c"
FT                   /note="compared to HLA-A*0287"
XX
SQ   Sequence 270 BP; 56 A; 82 C; 95 G; 37 T; 0 other;
     gctctcactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acgaggagac agggaaagtg aaggcccact cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer