Dbfetch

ID   EF679333; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   EF679333;
XX
DT   13-AUG-2007 (Rel. 92, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*4002new allele, exon 3
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Liu N., Shan X., Li W., Wang L., He X., Wang Z., Ni L., Cui S., Wang L.,
RA   Gong Z., Zhao B., Zhang Z.;
RT   "A novel allele identified by sequence-based typing";
RL   Unpublished.
XX
RN   [2]
RP   1-276
RA   Liu N., Shan X., Li W., Wang L., He X., Wang Z., Ni L., Cui S., Wang L.,
RA   Gong Z., Zhao B., Zhang Z.;
RT   ;
RL   Submitted (08-JUN-2007) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No.37 North Third Ring Road,
RL   Beijing 100088, China
XX
DR   MD5; 75ef952ade37021966f5b53154cd686f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4002new"
FT   mRNA            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4002new"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4002new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A7U4Z6"
FT                   /db_xref="IMGT/HLA:B*40:78"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A7U4Z6"
FT                   /protein_id="ABR22623.1"
FT                   /translation="SHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAV
FT                   DTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRA"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4002new"
FT                   /number=3
FT   variation       1..276
FT                   /gene="HLA-B"
FT                   /replace="c"
FT                   /note="A136V; compared to HLA-B*400201"
XX
SQ   Sequence 276 BP; 53 A; 86 C; 102 G; 35 T; 0 other;
     ggtctcacac cctccagagc atgtacggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggcataa ccagtacgcc tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcctggac cgccgtggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgtggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//