spacer

EBI Dbfetch

ID   EF660334; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EF660334;
XX
DT   01-AUG-2007 (Rel. 92, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1123new allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   PUBMED; 23066672.
RA   Wang D., Li W., Wang L., Xiaoyan S., Zhixin Z.;
RT   "Two new alleles, HLA-DRB1*11:64 and HLA-DRB1*04:67 identified in Chinese
RT   individuals";
RL   Tissue Antigens 80(6):553-554(2012).
XX
RN   [2]
RP   1-270
RA   Li W., Shan X., Liu N., Ni L., Wang L., Wang L., Cui S., Wang Z., He X.,
RA   Gong Z., Zhao B., Zhang Z.;
RT   "A novel allele identified by sequence-based typing";
RL   Unpublished.
XX
RN   [3]
RP   1-270
RA   Li W., Shan X., Liu N., Ni L., Wang L., Wang L., Cui S., Wang Z., He X.,
RA   Gong Z., Zhao B., Zhang Z.;
RT   ;
RL   Submitted (08-JUN-2007) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No.37 North Third Ring Road,
RL   Beijing 100088, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1123new"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1123new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1123new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:A7L3U7"
FT                   /db_xref="IMGT/HLA:DRB1*11:64"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A7L3U7"
FT                   /protein_id="ABR22622.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDLLEDRRALVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1123new"
FT                   /number=2
FT   variation       186
FT                   /gene="HLA-DRB1"
FT                   /replace="t"
FT                   /note="F67L; compared to HLA-DRB1*1123"
XX
SQ   Sequence 270 BP; 58 A; 63 C; 96 G; 53 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacctcct ggaagacagg cgggccctgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer