spacer

EBI Dbfetch

ID   EF656476; SV 1; linear; genomic DNA; STD; HUM; 1737 BP.
XX
AC   EF656476;
XX
DT   08-JUL-2007 (Rel. 92, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*2319Q allele, exons 2
DE   through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1737
RA   Shomper A.L., Eller S.R., Iglehart B.S., Leffell M.S.;
RT   "Identification of a Novel Allele: A*2319Q";
RL   Unpublished.
XX
RN   [2]
RP   1-1737
RA   Shomper A.L., Eller S.R., Iglehart B.S., Leffell M.S.;
RT   ;
RL   Submitted (07-JUN-2007) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St, Baltimore, MD
RL   21205, USA
XX
DR   MD5; a3e847591fada3ec0b10ac3184281cdd.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1737
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1737
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2319Q"
FT   mRNA            join(<78..347,589..864,1444..>1719)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2319Q"
FT                   /product="MHC class I antigen"
FT   CDS             join(<78..347,589..864,1444..>1719)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2319Q"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A6YT92"
FT                   /db_xref="IMGT/HLA:A*23:19Q"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A6YT92"
FT                   /protein_id="ABR68011.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VDGLRRYLENGKETLQRTNPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            78..347
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2319Q"
FT                   /number=2
FT   exon            589..864
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2319Q"
FT                   /number=3
FT   exon            1444..1719
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2319Q"
FT                   /number=4
XX
SQ   Sequence 1737 BP; 334 A; 535 C; 562 G; 306 T; 0 other;
     gcctggcggg ggcgcaagac ccgggaagcc gcgccgggag gagggtcggg cgggtctcag        60
     ccactcctcg tccccaggct cccactccat gaggtatttc tccacatccg tgtcccggcc       120
     cggccgcggg gagccccgct tcatcgccgt gggctacgtg gacgacacgc agttcgtgcg       180
     gttcgacagc gacgccgcga gccagaggat ggagccgcgg gcgccgtgga tagagcagga       240
     ggggccggag tattgggacg aggagacagg gaaagtgaag gcccactcac agactgaccg       300
     agagaacctg cggatcgcgc tccgctacta caaccagagc gaggccggtg agtgaccccg       360
     gcccggggcg caggtcacga cccctcatcc cccacggacg ggccgggtcg cccacagtct       420
     ccgggtccga gatccacccc gaagccgcgg gaccccgaga cccttgcccc gggagaggcc       480
     caggcgcctt aacccggttt cattttcagt ttaggccaaa aatccccccg ggttggtcgg       540
     ggccgggcgg ggctcggggg actgggctga ccgcggggtc ggggccaggt tctcacaccc       600
     tccagatgat gtttggctgc gacgtggggt cggacgggcg cttcctccgc gggtaccacc       660
     agtacgccta cgacggcaag gattacatcg ccctgaaaga ggacctgcgc tcttggaccg       720
     cggcggacat ggcggctcag atcacccagc gcaagtggga ggcggcccgt gtggcggagc       780
     agttgagagc ctacctggag ggcacgtgcg tggacgggct ccgcagatac ctggagaacg       840
     ggaaggagac gctgcagcgc acgagtacca ggggccacgg ggcgcctacc tgatcgcctg       900
     taggtctccc gggctggcct cccacaagga ggggagacaa ttgggaccaa cactagaata       960
     tcgccctccc tctggtcctg agggagagga atcctcctgg gtttccagat cctgtaccag      1020
     agagtgactc tgaggttccg ccctgctctc tgacacaatt aagggataaa atctctgacg      1080
     gaatgacgga aagacgatcc ctcgaatact gatgactggt tccctttgac accggcagca      1140
     gccttgggac cgtgactttt cctctcaggc cttgttctct gcttcacact caatgtgtgt      1200
     gggggtctga gtccagcact tctgagtccc tcagcctcca ctcaggtcag gaccagaagt      1260
     cgctgttccc tcctcaggga atagaagatt atcccaggtg cctgtgtcca ggctggtgtc      1320
     tgggttctgt gctctcttcc ccatcccggg tgtcctgtcc attctcaaga tggccacatg      1380
     catgctggtg gagtgtccca tgacagatgc aaaatgcctg aattttctga ctcttcccgt      1440
     cagacccccc caagacacat atgacccacc accccatctc tgaccatgag gccactctga      1500
     gatgctgggc cctgggcttc taccctgcgg agatcacact gacctggcag cgggatgggg      1560
     aggaccagac ccaggacacg gagcttgtgg agaccaggcc tgcaggggat ggaaccttcc      1620
     agaagtgggc agctgtggtg gtaccttctg gagaggagca gagatacacc tgccatgtgc      1680
     agcatgaggg tctgcccaag cccctcaccc tgagatgggg taaggaggga gatgggg         1737
//


spacer
spacer