Dbfetch

ID   EF656467; SV 1; linear; genomic DNA; STD; HUM; 786 BP.
XX
AC   EF656467;
XX
DT   18-JUL-2007 (Rel. 92, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens isolate BY00182 MHC class I antigen (HLA-A) gene,
DE   HLA-A*3003novel allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-786
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   "Novel HLA Class I allele";
RL   Unpublished.
XX
RN   [2]
RP   1-786
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   ;
RL   Submitted (07-JUN-2007) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; cb94301120ed070a5f0910b3fad26ecf.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..786
FT                   /organism="Homo sapiens"
FT                   /isolate="BY00182"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>786
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3003novel"
FT   mRNA            join(<1..270,512..>786)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3003novel"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..>786)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3003novel"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*30:22"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:A7L3S7"
FT                   /protein_id="ABS18719.1"
FT                   /translation="SHSMRYFSTSVSRPGSGEPRFIAVGYVDDTQFVRFDSDAASRRME
FT                   PRAPWIEQEGPEYWDGETRKVKAHSQTDRENLGTLRGYYNQSEAGSHTIQIMYGCDVGS
FT                   DGRFLRGYEQHAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARRAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3003novel"
FT                   /number=2
FT   gap             271..511
FT                   /estimated_length=241
FT   exon            512..786
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3003novel"
FT                   /number=3
XX
SQ   Sequence 786 BP; 112 A; 160 C; 195 G; 78 T; 241 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggcagt ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccggag gatggagccg cgggcgccgt ggatagagca ggagggtccg gagtattggg       180
     acggggagac acggaaagtg aaggcccact cacagactga ccgagagaac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngttctcaca ccatccagat aatgtatggc       540
     tgcgacgtgg ggtcggacgg gcgcttcctc cgcgggtatg aacagcacgc ctacgacggc       600
     aaggattaca tcgccctgaa cgaggacctg cgctcttgga ccgcggcgga catggcggct       660
     cagatcaccc agcgcaagtg ggaggcggcc cgtcgggcgg agcagttgag agcctacctg       720
     gagggcacgt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacg                                                                  786
//