spacer

EBI Dbfetch

ID   EF650024; SV 1; linear; genomic DNA; STD; HUM; 1693 BP.
XX
AC   EF650024;
XX
DT   04-JUL-2007 (Rel. 92, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-Cw*0346 allele, exons 1
DE   through 7 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1693
RX   DOI; 10.1111/j.1399-0039.2007.00940.x.
RX   PUBMED; 17900285.
RA   Endres R.O., Redman H., Baumbach A., Capper J.;
RT   "A novel HLA-C locus allele with codon 54 deletion, Cw*0346";
RL   Tissue Antigens 70(6):524-525(2007).
XX
RN   [2]
RP   1-1693
RA   Endres R.O., Redman H., Baumbach A., Capper J.;
RT   ;
RL   Submitted (04-JUN-2007) to the INSDC.
RL   HLA Laboratory, Blood Systems Laboratories, 2424 W Erie Dr, Tempe, AZ
RL   85282, USA
XX
DR   MD5; 08f44e5424bf0fe35e9d9ca20505319c.
DR   Ensembl-Gn; ENSG00000225691; homo_sapiens.
DR   Ensembl-Tr; ENST00000457903; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1693
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /collected_by="UCLA DNA Exchange"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1693
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0346"
FT   mRNA            join(<1..73,174..440,541..816,917..1192,1293..1412,
FT                   1513..1545,1646..>1693)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0346"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,174..440,541..816,917..1192,1293..1412,
FT                   1513..1545,1646..>1693)
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0346"
FT                   /product="MHC class I antigen"
FT                   /note="similar to HLA-C*030401"
FT                   /db_xref="GOA:A6YS06"
FT                   /db_xref="IMGT/HLA:C*03:46"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A6YS06"
FT                   /protein_id="ABR58849.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEEGPEYWDRETQKYKRQAQTDRVSLRNL
FT                   RGYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAA
FT                   QITQRKWEAAREAEQLRAYLEGLCVEWLRRYLKNGKETLQRAEHPKTHVTHHPVSDHEA
FT                   TLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYT
FT                   CHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGGK
FT                   GGSCSQAASSNSAQGSDESLIACK"
FT   exon            <1..73
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0346"
FT                   /number=1
FT   gap             74..173
FT                   /estimated_length=unknown
FT   exon            174..440
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0346"
FT                   /number=2
FT   gap             441..540
FT                   /estimated_length=unknown
FT   exon            541..816
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0346"
FT                   /number=3
FT   gap             817..916
FT                   /estimated_length=unknown
FT   exon            917..1192
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0346"
FT                   /number=4
FT   gap             1193..1292
FT                   /estimated_length=unknown
FT   exon            1293..1412
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0346"
FT                   /number=5
FT   gap             1413..1512
FT                   /estimated_length=unknown
FT   exon            1513..1545
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0346"
FT                   /number=6
FT   gap             1546..1645
FT                   /estimated_length=unknown
FT   exon            1646..>1693
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0346"
FT                   /number=7
XX
SQ   Sequence 1693 BP; 213 A; 327 C; 376 G; 177 T; 600 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttctaca ccgctgtgtc ccggcccggc cgcggggagc cccacttcat       240
     cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg ccgcgagtcc       300
     gagaggggag ccgcgggcgc cgtgggtgga ggaggggccg gagtattggg accgggagac       360
     acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc tgcgcggcta       420
     ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     ggtctcacat catccagagg atgtatggct gcgacgtggg gcccgacggg cgcctcctcc       600
     gcgggtatga ccagtacgcc tacgacggca aggattacat cgccctgaac gaggatctgc       660
     gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc       720
     gtgaggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg ctccgcagat       780
     acctgaagaa tgggaaggag acgctgcagc gcgcggnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnaaca cccaaagaca cacgtgaccc accatcccgt ctctgaccat       960
     gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac actgacctgg      1020
     cagtgggatg gggaggacca aactcaggac actgagcttg tggagaccag gccagcagga      1080
     gatggaacct tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga gcagagatac      1140
     acgtgccatg tgcagcacga ggggctgccg gagcccctca ccctgagatg ggnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnagccgtct tcccagccca ccatccccat      1320
     cgtgggcatc gttgctggcc tggctgtcct ggctgtccta gctgtcctag gagctgtggt      1380
     ggctgttgtg atgtgtagga ggaagagctc agnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nngtggaaaa ggagggagct gctctcaggc tgcgtnnnnn nnnnnnnnnn      1560
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1620
     nnnnnnnnnn nnnnnnnnnn nnnnnccagc aacagtgccc agggctctga tgagtctctc      1680
     atcgcttgta aag                                                         1693
//


spacer
spacer