Dbfetch

ID   EF640930; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EF640930;
XX
DT   30-JUN-2007 (Rel. 92, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*08 new allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Carcassi C., Lai S., Alba F., Cappai L., Testi M., Andreani M.;
RT   "A new DRB1*08 allele found in a Kurdi individual";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Carcassi C., Lai S., Alba F., Cappai L., Testi M., Andreani M.;
RT   ;
RL   Submitted (31-MAY-2007) to the INSDC.
RL   Genetica Medica, Universita Di Cagliari, Via is Guadazzonis, 3, Cagliari,
RL   CA 09126, Italy
XX
DR   MD5; a4dbf23dfb8e8386087d27a98dc28e1a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /note="PCR_primers=fwd_name: I1-RBSeq3"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*08 new"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*08 new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*08 new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:A6YQP1"
FT                   /db_xref="IMGT/HLA:DRB1*11:67"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A6YQP1"
FT                   /protein_id="ABR27732.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDFLEDRRALVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*08 new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 60 C; 98 G; 54 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccctgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//