spacer

EBI Dbfetch

ID   EF640739; SV 1; linear; genomic DNA; STD; HUM; 1022 BP.
XX
AC   EF640739;
XX
DT   30-JUN-2007 (Rel. 92, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-Cw*0716 allele, exons 2
DE   through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1022
RX   DOI; 10.1111/j.1399-0039.2007.00980.x.
RX   PUBMED; 18086268.
RA   Canossi A., Liberatore G., Del Beato T., Piazza A., Adorno D.;
RT   "Identification of the very uncommon allele HLA-Cw*0716 in a Caucasian
RT   renal transplant recipient: extension of the exon 4 sequence";
RL   Tissue Antigens 71(2):176-178(2008).
XX
RN   [2]
RP   1-1022
RA   Canossi A., Del Beato T., Piazza A., Liberatore G., Ozzella G., Poggi E.,
RA   Adorno D.;
RT   "Description of the unknown HLA-Cw*0716 exon 4 in a renal transplant
RT   recipient from Italy";
RL   Unpublished.
XX
RN   [3]
RP   1-1022
RA   Canossi A., Del Beato T., Piazza A., Liberatore G., Ozzella G., Poggi E.,
RA   Adorno D.;
RT   ;
RL   Submitted (31-MAY-2007) to the INSDC.
RL   Istituto Trapianti D'Organo e l'Immunocitologia, C.N.R., P.le Collemaggio,
RL   L'Aquila 67100, Italy
XX
DR   MD5; 881fb171baf48b3ecf4d923ed9580e4b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1022
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="E770"
FT                   /mol_type="genomic DNA"
FT                   /country="Italy"
FT                   /isolation_source="renal transplant recipient"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1022
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0716"
FT   mRNA            join(<1..270,371..646,747..>1022)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0716"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..646,747..>1022)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0716"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A6YQG8"
FT                   /db_xref="IMGT/HLA:C*07:16"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A6YQG8"
FT                   /protein_id="ABR27677.1"
FT                   /translation="SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQNYKRQAQADRVSLRNLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSW"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0716"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0716"
FT                   /number=3
FT   gap             647..746
FT                   /estimated_length=unknown
FT   exon            747..1022
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0716"
FT                   /number=4
FT                   /note="similar to the HLA-Cw*07020101 allele"
XX
SQ   Sequence 1022 BP; 168 A; 262 C; 283 G; 109 T; 200 other;
     gctcccactc catgaggtat ttcgacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaactac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtatggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac accgcggctc agatcaccca gcgcaagttg       540
     gaggcggccc gtgcggcgga gcagctgaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcagnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnaacc cccaaagaca cacgtgaccc accaccccct       780
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac       840
     actgacctgg cagcgggatg gggaggacca gacccaggac accgagcttg tggagaccag       900
     gccagcagga gatggaacct tccagaagtg ggcagctgtg gtggtgcctt ctggacaaga       960
     gcagagatac acgtgccata tgcagcacga ggggctgcaa gagcccctca ccctgagctg      1020
     gg                                                                     1022
//


spacer
spacer