spacer

EBI Dbfetch

ID   EF612726; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   EF612726;
XX
DT   10-JUN-2007 (Rel. 92, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*40N allele, exon 3 and
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RX   PUBMED; 23398513.
RA   Gong Z., Zhang Z., Shan X., Li W., Liu N.;
RT   "A novel HLA-B allele, B*40:01:06, identified by sequence-based typing in a
RT   Chinese individual";
RL   Tissue Antigens 81(3):176-177(2013).
XX
RN   [2]
RP   1-276
RA   Wang L., Shan X., Ni L., Wang Z., Cui S., Liu N., Li W., He X., Wang L.,
RA   Zhao B., Gong Z., Zhang Z.;
RT   "A novel allele B*40 identified by sequence-based typing";
RL   Unpublished.
XX
RN   [3]
RP   1-276
RA   Wang L., Shan X., Ni L., Wang Z., Cui S., Liu N., Li W., He X., Wang L.,
RA   Zhao B., Gong Z., Zhang Z.;
RT   ;
RL   Submitted (24-APR-2007) to the INSDC.
RL   HLA Laboratory, Beijing Red Cross Blood Center, No. 37 North Third Ring
RL   Road, Beijing 100088, China
XX
DR   MD5; 64d530d9f9b200a44dd6de44c61ed9f6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40N"
FT   mRNA            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40N"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40N"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A5Z1V7"
FT                   /db_xref="IMGT/HLA:B*40:01:06"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A5Z1V7"
FT                   /protein_id="ABQ95533.1"
FT                   /translation="SHTLQRMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAA
FT                   DTAAQISQRKLEAARVAEQLRAYLEGECVEWLRRYLENGKDKLERA"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40N"
FT                   /number=3
FT   variation       92
FT                   /gene="HLA-B"
FT                   /replace="g"
FT                   /note="compared to allele HLA-B*400101"
XX
SQ   Sequence 276 BP; 54 A; 85 C; 100 G; 37 T; 0 other;
     ggtctcacac cctccagagg atgtacggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggcataa ccagtacgcc tacgacggca aagattacat cgccctgaac gaggacctgc       120
     gctcctggac cgccgcggac acggcggctc agatctccca gcgcaagttg gaggcggccc       180
     gtgtggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggac aagctggagc gcgctg                                 276
//


spacer
spacer