Dbfetch

ID   EF565823; SV 1; linear; genomic DNA; STD; HUM; 1848 BP.
XX
AC   EF565823;
XX
DT   08-MAY-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-G) gene, HLA-G*005 allele, exons 1
DE   through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1848
RX   DOI; 10.1111/j.1399-0039.2007.00902.x.
RX   PUBMED; 17767566.
RA   Castelli E.C., Mendes-Junior C.T., Wiezel C.E., Peres N.T., Simoes A.L.,
RA   Rossi N.M., Donadi E.A.;
RT   "A novel HLA-G allele, HLA-G*010111, in the Brazilian population";
RL   Tissue Antigens 70(4):349-350(2007).
XX
RN   [2]
RP   1-1848
RA   Castelli E.C., Mendes-Junior C.T., Peres N.T.A., Rossi N.M.M., Donadi E.A.;
RT   ;
RL   Submitted (19-APR-2007) to the INSDC.
RL   Division of Clinical Immunology, Department of Medicine, School of Medicine
RL   of Ribeirao Preto, University of Sao Paulo, Av. Bandeirantes 3900, Ribeirao
RL   Preto, Sao Paulo 14049-900, Brazil
XX
DR   MD5; f80d6fdfc5b2c6bfff1966672d61a745.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1848
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1848
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*005"
FT   mRNA            join(<1..73,203..472,699..974,1573..>1848)
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*005"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,203..472,699..974,1573..>1848)
FT                   /codon_start=1
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*005"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:G*01:01:11"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A5HSK0"
FT                   /protein_id="ABQ12769.1"
FT                   /translation="MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPR
FT                   FIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQT
FT                   LRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTA
FT                   AQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYE
FT                   ATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLMLRW"
FT   exon            1..73
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*005"
FT                   /number=1
FT   exon            203..472
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*005"
FT                   /number=2
FT   exon            699..974
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*005"
FT                   /number=3
FT   gap             975..1360
FT                   /estimated_length=386
FT   exon            1573..1848
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*005"
FT                   /number=4
XX
SQ   Sequence 1848 BP; 273 A; 452 C; 502 G; 235 T; 386 other;
     atggtggtca tggcgccccg aaccctcttc ctgctgctct cgggggccct gaccctgacc        60
     gagacctggg cgggtgagtg cggggtcagg agggaaacag cccctgcgcg gaggagggag       120
     gggccggccc ggcgggggcg caggactcgg cagccgcgcc gggaggaggg tcgggcgggt       180
     ctcaacccct cctcgccccc aggctcccac tccatgaggt atttcagcgc cgccgtgtcc       240
     cggcccggcc gcggggagcc ccgcttcatc gccatgggct acgtggacga cacgcagttc       300
     gtgcggttcg acagcgactc ggcgtgtccg aggatggagc cgcgggcgcc gtgggtggag       360
     caggaggggc cggagtattg ggaagaggag acacggaaca ccaaggccca cgcacagact       420
     gacagaatga acctgcagac cctgcgcggc tactacaacc agagcgaggc cagtgagtaa       480
     ctccggccca gggagcagat cacgaccccc acctccatgc cccacggacg gcccgggtac       540
     tcccgagtct ccgggtctgg gatccacccc gaggccgcgg gacccgccca gaccctctac       600
     ctgggagaac cccaaggcgc ctttaccaaa atccccgcgg gtgggtccgg gcgagggcga       660
     ggctcggtgg gcggggctga ccgagggggt ggggccaggt tctcacaccc tccagtggat       720
     gattggctgc gacctggggt ccgacggacg cctcctccgc gggtatgaac agtatgcgta       780
     cgatggcaag gattacctcg ccctgaacga ggacctgcgc tcctggaccg cagcggacac       840
     tgcggctcag atctccaagc gcaagtgtga ggcggccaat gtggctgaac aaaggagagc       900
     ctacctggag ggcacgtgcg tggagtggct ccacagatac ctggagaacg ggaaggagat       960
     gctgcagcgc gcggnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn accggaggtc cctgctcccc      1380
     cgctcagaga ctagaacttt ccaaggaata ggagattatc ccaggtgccc gtgtccaggc      1440
     tggtgtctgg gttctgtgct cccttcccca ccccaggtat ctggttcatt cttaggatgg      1500
     tcacatccag gtgctgctgg agtgtcccat gagagatgca aagtgcttga attttctgac      1560
     tcttcctttc agaccccccc aagacacacg tgacccacca ccctgtcttt gactatgagg      1620
     ccaccctgag gtgctgggcc ctgggcttct accctgcgga gatcatactg acctggcagc      1680
     gggatgggga ggaccagacc caggacgtgg agctcgtgga gaccaggcct gcaggggatg      1740
     gaaccttcca gaagtgggca gctgtggtgg tgccttctgg agaggagcag agatacacgt      1800
     gccatgtgca gcatgagggg ctgccggagc ccctcatgct gagatgga                   1848
//