spacer

EBI Dbfetch

ID   EF550999; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EF550999;
XX
DT   23-MAY-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*07 new allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Schmitt F., Regen L., Smith A.;
RT   "Novel DRB1 alleles detected in a hematopoietic stem cell population";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Schmitt F., Regen L., Smith A.;
RT   ;
RL   Submitted (12-APR-2007) to the INSDC.
RL   Clinical Immunogenetics Lab, Seattle Cancer Care Alliance, 825 Eastlake
RL   Ave. E., Seattle, WA 98109, USA
XX
DR   MD5; 8da294d108a1a70137c14af12b045e2d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*07 new"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*07 new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*07 new"
FT                   /product="MHC class II antigen"
FT                   /note="HLA DR7 antigen beta 1 domain"
FT                   /db_xref="GOA:A5JNG9"
FT                   /db_xref="IMGT/HLA:DRB1*07:14"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A5JNG9"
FT                   /protein_id="ABQ40393.1"
FT                   /translation="RFLWQGKYKCHFFNGTERVQFLERLFYNQGEFVRFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDILEDRRGQVDTVCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*07 new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 57 A; 63 C; 101 G; 49 T; 0 other;
     cacgtttcct gtggcagggt aagtataagt gtcatttctt caacgggacg gagcgggtgc        60
     agttcctgga aagactcttc tataaccagg gggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctagggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacatcct ggaggacagg cggggccagg tggacaccgt gtgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer