spacer

EBI Dbfetch

ID   EF545134; SV 1; linear; genomic DNA; STD; HUM; 885 BP.
XX
AC   EF545134;
XX
DT   12-MAY-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*new allele, exons 2, 3
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-885
RA   Christiansen M., Bonde L., Graugaard B., Moeller B.K.;
RT   "Characterization of a new HLA-B*44 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-885
RA   Christiansen M., Bonde L., Graugaard B., Moeller B.K.;
RT   ;
RL   Submitted (10-APR-2007) to the INSDC.
RL   Department of Clinical Immunology, Aarhus University Hospital, Skejby,
RL   Brendstrupgaardsvej 100, Aarhus N 8200, Denmark
XX
DR   MD5; 590099b59cabbf503d58c6f493f39fb5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..885
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>885
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*new"
FT   mRNA            join(<33..302,546..>821)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*new"
FT   CDS             join(<33..302,546..>821)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*new"
FT                   /product="MHC class I antigen"
FT                   /note="antigen presenting molecule"
FT                   /db_xref="GOA:A5HNU4"
FT                   /db_xref="IMGT/HLA:B*44:54"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A5HNU4"
FT                   /protein_id="ABQ16592.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VESLRRYLENGKETLQRA"
FT   exon            33..302
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*new"
FT                   /number=2
FT   exon            546..821
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*new"
FT                   /number=3
XX
SQ   Sequence 885 BP; 154 A; 304 C; 310 G; 117 T; 0 other;
     tcgggcgggt ctcagcccct cctcgccccc aggctcccac tccatgaggt atttctacac        60
     cgccatgtcc cggcccggcc gcggggagcc ccgcttcatc accgtgggct acgtggacga       120
     cacgctgttc gtgaggttcg acagcgacgc cacgagtccg aggaaggagc cgcgggcgcc       180
     atggatagag caggaggggc cggagtattg ggaccgggag acacagatct ccaagaccaa       240
     cacacagact taccgagaga acctgcgcac cgcgctccgc tactacaacc agagcgaggc       300
     cggtgagtga ccccggcccg gggcgcaggt cacgactccc catcccccac gtacggcccg       360
     ggtcgccccg agtctccggg tccgagatcc gcccccgagg ccgcgggacc cgcccagacc       420
     ctcgaccggc gagagcccca ggcgcgttta cccggtttca ttttcagttg aggccaaaat       480
     ccccgcgggt tggtcggggc ggggcggggc tcgggggacg gggctgaccg cggggccggg       540
     gccagggtct cacaccctcc agagcatgta cggctgcgac gtggggccgg acgggcgcct       600
     cctccgcggg tatgaccagg acgcctacga cggcaaggat tacatcgccc tgaacgagga       660
     cctgagctcc tggaccgcgg cggacaccgc ggctcagatc acccagcgca agtgggaggc       720
     ggcccgtgtg gcggagcagc tgagagccta cctggagggc ctgtgcgtgg agtcgctccg       780
     cagatacctg gagaacggga aggagacgct gcagcgcgcg ggtaccaggg gcagtgggga       840
     gccttcccca tctcctatag gtcgccgggg atggcctccc acgag                       885
//


spacer
spacer