spacer

EBI Dbfetch

ID   EF540341; SV 2; linear; genomic DNA; STD; HUM; 1545 BP.
XX
AC   EF540341;
XX
DT   13-MAY-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*5149 allele, exons 1
DE   through 6 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1545
RX   DOI; 10.1111/j.1399-0039.2007.00889.x.
RX   PUBMED; 17661919.
RA   Endres R.O., Redman H., Scavello G.S.;
RT   "A novel HLA-B*51 allele, HLA-B*5149";
RL   Tissue Antigens 70(3):259-260(2007).
XX
RN   [2]
RP   1-1545
RA   Endres R.O., Scavello G., Redman H.;
RT   ;
RL   Submitted (06-APR-2007) to the INSDC.
RL   HLA Laboratory, Blood Systems Laboratories, 2424 W Erie Dr, Tempe, AZ
RL   85282, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-1545
RA   Endres R.O., Scavello G., Redman H.;
RT   ;
RL   Submitted (21-MAY-2007) to the INSDC.
RL   HLA Laboratory, Blood Systems Laboratories, 2424 W Erie Dr, Tempe, AZ
RL   85282, USA
XX
DR   MD5; d53bc40e418e1d3ea6894f0fc576b335.
XX
CC   On May 21, 2007 this sequence version replaced gi:146289919.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1545
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1545
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5149"
FT   mRNA            join(<1..73,174..443,544..819,920..1195,1296..1412,
FT                   1513..>1545)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5149"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,174..443,544..819,920..1195,1296..1412,
FT                   1513..>1545)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5149"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A5HM76"
FT                   /db_xref="IMGT/HLA:B*51:49"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A5HM76"
FT                   /protein_id="ABQ18299.2"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRI
FT                   ALRYYNQSEAGSHTWQTMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTG
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRHLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAA"
FT   exon            <1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5149"
FT                   /number=1
FT   gap             74..173
FT                   /estimated_length=unknown
FT   exon            174..443
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5149"
FT                   /number=2
FT   gap             444..543
FT                   /estimated_length=unknown
FT   exon            544..819
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5149"
FT                   /number=3
FT   gap             820..919
FT                   /estimated_length=unknown
FT   exon            920..1195
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5149"
FT                   /number=4
FT   gap             1196..1295
FT                   /estimated_length=unknown
FT   exon            1296..1412
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5149"
FT                   /number=5
FT   gap             1413..1512
FT                   /estimated_length=unknown
FT   exon            1513..>1545
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5149"
FT                   /number=6
XX
SQ   Sequence 1545 BP; 217 A; 319 C; 346 G; 163 T; 500 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttctaca ccgccatgtc ccggcccggc cgcggggagc cccgcttcat       240
     tgcagtgggc tacgtggacg acacccagtt cgtgaggttc gacagcgacg ccgcgagtcc       300
     gaggacggag ccccgggcgc catggataga gcaggagggg ccggagtatt gggaccggaa       360
     cacacagatc ttcaagacca acacacagac ttaccgagag aacctgcgga tcgcgctccg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca cacttggcag acgatgtatg gctgcgacgt ggggccggac gggcgcctcc       600
     tccgcgggca taaccagtac gcctacgacg gcaaagatta catcgccctg aacgaggacc       660
     tgagctcctg gaccgcggcg gacaccgggg ctcagatcac ccagcgcaag tgggaggcgg       720
     cccgtgaggc ggagcagctg agagcctacc tggagggcct gtgcgtggag tggctccgca       780
     gacacctgga gaacgggaag gagacgctgc agcgcgcggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna ccccccaaag acacacgtga cccaccaccc cgtctctgac       960
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca      1080
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga      1140
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnagcca tcttcccagt ccaccatccc      1320
     catcgtgggc attgttgctg gcctggctgt cctagcagtt gtggtcatcg gagctgtggt      1380
     cgctactgtg atgtgtagga ggaagagctc agnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nngtggaaaa ggagggagct actctcaggc tgcgt                      1545
//


spacer
spacer