spacer

EBI Dbfetch

ID   EF534104; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   EF534104;
XX
DT   08-MAY-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*02new allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Sprague M., Smith A., Hansen J.A.;
RT   "Novel HLA-A*02 allele in a hematopoietic stem cell transplant population";
RL   Unpublished.
XX
RN   [2]
RP   1-646
RA   Sprague M., Smith A., Hansen J.A.;
RT   ;
RL   Submitted (02-APR-2007) to the INSDC.
RL   Clinical Immunogenetics, Seattle Cancer Care Alliance, 825 Eastlake Ave.
RL   E., Seattle, WA 98109, USA
XX
DR   MD5; 850c66e7dac472f781bc3a7ddb36d7e6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A5HJL0"
FT                   /db_xref="IMGT/HLA:A*02:121"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A5HJL0"
FT                   /protein_id="ABQ01715.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGS
FT                   DWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   gap             271..370
FT                   /estimated_length=unknown
XX
SQ   Sequence 646 BP; 110 A; 161 C; 195 G; 80 T; 100 other;
     gctctcactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagggtccg gagtattggg       180
     acggggagac acggaaagtg aaggcccact cacagactca ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac cgtccagagg atgtatggct gcgacgtggg gtcggactgg       420
     cgcttcctcc gcgggtacca ccagtacgcc tacgacggca aggattacat cgccctgaaa       480
     gaggacctgc gctcttggac cgcggcggac atggcagctc agaccaccaa gcacaagtgg       540
     gaggcggccc atgtggcgga gcagttgaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer