spacer

EBI Dbfetch

ID   EF521874; SV 1; linear; genomic DNA; STD; HUM; 1689 BP.
XX
AC   EF521874;
XX
DT   01-MAY-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*40 allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1689
RX   DOI; 10.1111/j.1399-0039.2007.00890.x.
RX   PUBMED; 17767561.
RA   Sanchez-Gordo F., Balas A., Garcia-Sanchez F., Prat I., Vicario J.L.;
RT   "Description of a new HLA-B allele: HLA-B*4077";
RL   Tissue Antigens 70(4):343-344(2007).
XX
RN   [2]
RP   1-1689
RA   Sanchez-Gordo F., Balas A., Vicario J.L.;
RT   ;
RL   Submitted (26-MAR-2007) to the INSDC.
RL   Histocompatibility, CTM, Avenida De La Democracia S/N, Madrid 28032, Spain
XX
DR   MD5; 7228d0e87d6038696b6e5858e664835e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1689
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1689
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT   mRNA            join(<1..73,174..443,544..819,920..1195,1296..1412,
FT                   1513..1545,1646..>1689)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,174..443,544..819,920..1195,1296..1412,
FT                   1513..1545,1646..1689)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /product="MHC class I antigen"
FT                   /note="histocompatibility antigen"
FT                   /db_xref="GOA:A5A340"
FT                   /db_xref="IMGT/HLA:B*40:77"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A5A340"
FT                   /protein_id="ABP87680.1"
FT                   /translation="MRVTAPRTVLLLLSAALALTETWAGSHSMRYFHAAMSRPGRGEPR
FT                   FITVGYVDDALFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKLEAARVAEQLRAYLEGECVEWLRRYLENGKDKMERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   gap             74..173
FT                   /estimated_length=unknown
FT   gap             444..543
FT                   /estimated_length=unknown
FT   gap             820..919
FT                   /estimated_length=unknown
FT   gap             1196..1295
FT                   /estimated_length=unknown
FT   gap             1413..1512
FT                   /estimated_length=unknown
FT   gap             1546..1645
FT                   /estimated_length=unknown
XX
SQ   Sequence 1689 BP; 221 A; 333 C; 362 G; 173 T; 600 other;
     atgcgggtca cggcaccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttccacg ccgccatgtc ccggcccggc cgcggggagc cccgcttcat       240
     caccgtgggc tacgtggacg acgcgctgtt cgtgaggttc gacagcgacg ccacgagtcc       300
     gaggaaggag ccgcgggcgc catggataga gcaggagggg ccggagtatt gggaccggga       360
     gacacagatc tccaagacca acacacagac ttaccgagag agcctgcgga acctgcgcgg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca caccctccag aggatgtacg gctgcgacgt ggggccggac gggcgcctcc       600
     tccgcgggca taaccagttc gcctacgacg gcaaggatta catcgccctg aacgaggacc       660
     tgagctcctg gaccgcggcg gacaccgcgg ctcagatcac ccagcgcaag ttggaggcgg       720
     cccgtgtggc ggagcagctg agagcctacc tggagggcga gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gacaagatgg agcgcgcggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna ccccccaaag acacacgtga cccaccaccc catctctgac       960
     catgaggcca ccctgaggtg ctgggccctg ggtttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca      1080
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga      1140
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnagccg tcttcccagt ccaccgtccc      1320
     catcgtgggc attgttgctg gcctggctgt cctagcagtt gtggtcatcg gagctgtggt      1380
     cgctgctgtg atgtgtagga ggaagagttc agnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nngtggaaaa ggagggagct actctcaggc tgcgtnnnnn nnnnnnnnnn      1560
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1620
     nnnnnnnnnn nnnnnnnnnn nnnnngcagc gacagtgccc agggctctga tgtgtctctc      1680
     acagcttga                                                              1689
//


spacer
spacer