spacer

EBI Dbfetch

ID   EF517947; SV 1; linear; genomic DNA; STD; HUM; 1845 BP.
XX
AC   EF517947;
XX
DT   23-APR-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*0756 allele, exons 2
DE   through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1845
RA   Sikorski P.M., Eller S.R., Iglehart B.S., Leffell M.S.;
RT   ;
RL   Submitted (23-MAR-2007) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St, Baltimore, MD
RL   21205, USA
XX
DR   MD5; 517634f6409fa1e6c372010230fea714.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1845
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1845
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0756"
FT   mRNA            join(<54..323,569..844,1419..1694,1788..>1845)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0756"
FT                   /product="MHC class I antigen"
FT   CDS             join(<54..323,569..844,1419..1694,1788..>1845)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0756"
FT                   /product="MHC class I antigen"
FT                   /note="major histocompatibility complex; human leukocyte
FT                   antigen B"
FT                   /db_xref="GOA:A5A163"
FT                   /db_xref="IMGT/HLA:B*07:56:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A5A163"
FT                   /protein_id="ABP57377.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGEC
FT                   VEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTV
FT                   PIVGIVAGLAVL"
FT   exon            54..323
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0756"
FT                   /number=2
FT   exon            569..844
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0756"
FT                   /number=3
FT   exon            1419..1694
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0756"
FT                   /number=4
FT   exon            1788..>1845
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0756"
FT                   /number=5
XX
SQ   Sequence 1845 BP; 353 A; 578 C; 584 G; 330 T; 0 other;
     ggagccgcgc cgggaggagg gtcgggcggg tctcagcccc tcctcacccc caggctccca        60
     ctccatgagg tatttctaca cctccgtgtc ccggcccggc cgcggggagc cccgcttcat       120
     cgcagtgggc tacgtggacg acacgcagtt cgtgaggttc gacagcgacg ccgcgagtcc       180
     gagagaggag ccgcgggcgc cgtggataga gcaggagggg ccggagtatt gggaccggaa       240
     cacacagatc tacaaggccc aggcacagac tgaccgagag agcctgcgga acctgcgcgg       300
     ctactacaac cagagcgagg ccggtgagtg accccggccc ggggcgcagg tcacgactcc       360
     ccatccccca cgtacggccc gggtcgcccc gagtctccgg gtccgagatc cgcctccctg       420
     aggccgcggg acccgcccag accctcgacc ggcgagagcc ccaggcgcgt ttacccggtt       480
     tcattttcag ttgaggccaa aatccccgcg ggttggtcgg ggcggggcgg ggctcggggg       540
     actgggctga ccgcggggcc ggggccaggg tctcacaccc tccagagcat gtacggctgc       600
     gacgtggggc cggacgggcg cctcctccgc gggcatgacc agtacgccta cgacggcaag       660
     gattacatcg ccctgaacga ggacctgcgc tcctggaccg ccgcggacac ggcggctcag       720
     atcacccagc gcaagtggga ggcggcccgt gaggcggagc agcggagagc ctacctggag       780
     ggcgagtgcg tggagtggct ccgcagatac ctggagaacg ggaaggacaa gctggagcgc       840
     gctggtacca ggggcagtgg ggagccttcc ccatctccta taggtcgccg gggatggcct       900
     cccacgagaa gaggaggaaa atgggatcag cgctagaatg tcgccctccg ttgaatggag       960
     aatggcatga gttttcctga gtttcctctg agggccccct cttctctcta gacaattaag      1020
     gaatgacgtc tctgaggaaa tggaggggaa gacagtccct agaatactga tcaggggtcc      1080
     cctttgaccc ctgcagcagc cttgggaacc gtgacttttc ctctcaggcc ttgttctctg      1140
     cctcacactc agtgtgtttg gggctctgat tccagcactt ctgagtcact ttacctccac      1200
     tcagatcagg agcagaagtc cctgttcccc gctcagagac tcgaactttc caatgaatag      1260
     gagattatcc caggtgcctg cgtccaggct ggtgtctggg ttctgtgccc cttccccacc      1320
     ccaggtgtcc tgtccattct caggctggtc acatgggtgg tcctagggtg tcccatgaaa      1380
     gatgcaaagc gcctgaattt tctgactctt cccatcagac cccccaaaga cacacgtgac      1440
     ccaccacccc atctctgacc atgaggccac cctgaggtgc tgggccctgg gtttctaccc      1500
     tgcggagatc acactgacct ggcagcggga tggcgaggac caaactcagg acactgagct      1560
     tgtggagacc agaccagcag gagatagaac cttccagaag tgggcagctg tggtggtgcc      1620
     ttctggagaa gagcagagat acacatgcca tgtacagcat gaggggctgc cgaagcccct      1680
     caccctgaga tggggtaagg agggggatga ggggtcatat ctcttctcag ggaaagcagg      1740
     agcccttcag cagggtcagg gcccctcatc ttcccctcct ttcccagagc cgtcttccca      1800
     gtccaccgtc cccatcgtgg gcattgttgc tggcctggct gtcct                      1845
//


spacer
spacer