Dbfetch

ID   EF502101; SV 1; linear; genomic DNA; STD; HUM; 2909 BP.
XX
AC   EF502101;
XX
DT   01-MAY-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*68 variant allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2909
RA   Balas A., Garcia-Sanchez F., Vicario J.L.;
RT   "Sequencing of a new HLA-A*68 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-2909
RA   Balas A., Garcia-Sanchez F., Vicario J.L.;
RT   ;
RL   Submitted (19-MAR-2007) to the INSDC.
RL   Histocompatibility, CTM, Avenida de la Democracia, Madrid 28032, Spain
XX
DR   MD5; e0d658b73c5edcf24851ea6deecfc7b2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2909
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2909
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68 variant"
FT   mRNA            join(<1..73,204..473,707..982,1583..1858,1958..2074,
FT                   2513..2545,2688..2735,2905..>2909)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,707..982,1583..1858,1958..2074,
FT                   2513..2545,2688..2735,2905..2909)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68 variant"
FT                   /product="MHC class I antigen"
FT                   /note="histocompatibility molecule; human leukocyte
FT                   antigen"
FT                   /db_xref="GOA:Q1ELT0"
FT                   /db_xref="IMGT/HLA:A*68:02:01:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q1ELT0"
FT                   /protein_id="ABP88249.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEAGSHTIQRMYGCDVGPDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
XX
SQ   Sequence 2909 BP; 567 A; 832 C; 905 G; 605 T; 0 other;
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggtgagtg cggggtcggg agggaaacgg cctctgtggg gagaagcaag       120
     gggcccgccc ggcgggggcg caggacccgg gaagccgcgc ctggaggagg gtcgggcggg       180
     tctcagccac tcctcgcccc caggctccca ctccatgagg tatttctaca cctccatgtc       240
     ccggcccggc cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       360
     gcaggagggg ccggagtatt gggaccggaa cacacggaat gtgaaggccc agtcacagac       420
     tgaccgagtg gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggtgagtg       480
     accccggccc ggggcgcagg cctcatcccc cacggacggg ccaggtcgcc cacagtctcc       540
     gggtccgaga tccgccccga agccgcggga ccccgagacc cttgccccgg gagaggccca       600
     ggcgccttta cccggtttca ttttcagttt aggccaaaaa tccccccggg ttggtcgggg       660
     cggggcgggg ctcgggggac cgggctgacc tcggggtccg ggccaggttc tcacaccatc       720
     cagaggatgt atggctgcga cgtggggccg gacgggcgct tcctccgcgg gtaccaccag       780
     tacgcctacg acggcaagga ttacatcgcc ctgaaagagg acctgcgctc ttggaccgcg       840
     gcggacatgg cagctcagac caccaagcac aagtgggagg cggcccatgt ggcggagcag       900
     tggagagcct acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg       960
     aaggagacgc tgcagcgcac gggtaccagg ggccacgggg cgcctccctg atcgcctgta      1020
     gatctcccgg gctggcctcc cacaaggagg ggagacaatt gggaccaaca ctagaatatc      1080
     gccctccctc tggtcctgag ggagaggaat cctcctgggt ttccagatcc tgtaccagag      1140
     agtgactctg aggttccgcc ctgctctctg acacaattaa gggataaaat ctctgaagga      1200
     atgacgggaa gacgatccct cgaatactga tgagtggttc cctttgacac acacaggcag      1260
     cagccttggg cccgtgactt ttcctctcag gccttgttct ctgcttcaca ctcaatgtgt      1320
     gtgggggtct gagtccagca cttctgagtc cctcagcctc cactcaggtc aggaccagaa      1380
     gtcgctgttc cctcttcagg gactagaatt ttccacggaa taggagatta tcccaggtgc      1440
     ctgtgtccag gctggtgtct gggttctgtg ctcccttccc catcccaggt gtcctgtcca      1500
     ttctcaagat agccacatgt gtgctggagg agtgtcccat gacagatgca aaatgcctga      1560
     atgatctgac tcttcctgac agacgccccc aaaacgcata tgactcacca cgctgtctct      1620
     gaccatgaag ccaccctgag gtgctgggcc ctgagcttct accctgcgga gatcacactg      1680
     acctggcagc gggatgggga ggaccagacc caggacacgg agctcgtgga gaccaggcct      1740
     gcaggggatg gaaccttcca gaagtgggtg gctgtggtgg tgccttctgg acaggagcag      1800
     agatacacct gccatgtgca gcatgagggt ttgcccaagc ccctcaccct gagatggggt      1860
     aaggagggag acgggggtgt catgtctttt agggaaagca ggagcctctc tgacctttag      1920
     cagggtcagg gcccctcacc ttcccctctt ttcccagagc cgtcttccca gcccaccatc      1980
     cccatcgtgg gcatcattgc tggcctggtt ctctttggag ctgtgatcac tggagctgtg      2040
     gtcgctgctg tgatgtggag gaggaagagc tcaggtgggg aaggggtgaa gggtgggtct      2100
     gagatttctt gtctcactga gggttccaag acccaggtag aagtgtgccc tgcctcgtta      2160
     ctgggaagca ccacccacaa ttatgggcct acccagcctg ggccctgtgt gccagcactt      2220
     actcttttgt aaagcacctg ttaaaatgaa ggacagattt atcaccttga ttacagcggt      2280
     gatgggacct gatcccagca gtcacaagtc acaggggaag gtccctgagg accttcagga      2340
     gggcggttgg tccaggaccc acacctgctt tcttcatgtt tcctgatccc gccctgggtc      2400
     tgcagtcaca catttctgga aacttctctg aagtccaaga cttggaggtt cctctaggac      2460
     cttaaggccc tgactccttt ctggtatctc acaggacatt ttcttcccac agatagaaaa      2520
     ggagggagct actctcaggc tgcaagtaag tatgaaggag gctgatgcct gaggtccttg      2580
     ggatattgtg tttgggagcc catgggggag ctcacccacc ccacaattcc tcctctagcc      2640
     acatcttctg tgggatctga ccaggttctg tttttgttct accccaggca gtgacagtgc      2700
     ccagggctct gatgtgtctc tcacagcttg taaaggtgag agcctggagg gcctgatgtg      2760
     tgttgggtgt tgggcggaac agtggacaca gctgtgctat ggggtttctt tccattggat      2820
     gtattgagca tgcgatgggc tgtttaaagt gtgacccctc actgtgacag atacgaattt      2880
     gttcatgaat atttttttct atagtgtga                                        2909
//