Dbfetch

ID   EF495153; SV 1; linear; genomic DNA; STD; HUM; 786 BP.
XX
AC   EF495153;
XX
DT   20-APR-2007 (Rel. 91, Created)
DT   13-JAN-2009 (Rel. 99, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*4076 allele, exons 2,
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-786
RX   DOI; 10.1111/j.1399-0039.2008.01162.x.
RX   PUBMED; 19140836.
RA   Li S.Y., Xie J.H., DOng L., Yan L.N., Yuang Y.H.;
RT   "Identification of the novel allele HLA-B*4076 by sequence-based typing in
RT   a Chinese individual";
RL   Tissue Antigens 73(1):68-69(2009).
XX
RN   [2]
RP   1-786
RA   Yan L.N., An S.P., Li S.Y., Xie J.H., Dong L., Dong Z., Yuan Y.H.;
RT   "A new HLA-B*40 allele detected with SBT";
RL   Unpublished.
XX
RN   [3]
RP   1-786
RA   Yan L.N., An S.P., Li S.Y., Xie J.H., Dong L., Dong Z., Yuan Y.H.;
RT   ;
RL   Submitted (16-MAR-2007) to the INSDC.
RL   Tissue Typing Lab, Tianjin Blood Center, No. 424 Huanghe Road, Tianjin
RL   300110, China
XX
DR   MD5; 8d4b7734184fb93744308b3cc3c77eb6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..786
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="Protrans HLA-B-S4B9"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /note="PCR_primers=fwd_name: HLA-B-E3F, rev_name:
FT                   HLA-B-E2R"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>786
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4076"
FT   mRNA            join(<1..270,511..>786)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4076"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,511..>786)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4076"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*40:76"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:A4ZY85"
FT                   /protein_id="ABP38038.1"
FT                   /translation="SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRKLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKDKLERA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4076"
FT                   /number=2
FT   variation       239
FT                   /gene="HLA-B"
FT                   /replace="c"
FT                   /note="compared to allele B*4001"
FT   gap             271..510
FT                   /estimated_length=240
FT   exon            511..786
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4076"
FT                   /number=3
XX
SQ   Sequence 786 BP; 114 A; 171 C; 189 G; 72 T; 240 other;
     gctcccactc catgaggtat ttccacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ggtctcacac cctccagagg atgtacggct       540
     gcgacgtggg gccggacggg cgcctcctcc gcgggcataa ccagtacgcc tacgacggca       600
     aggattacat cgccctgaac gaggacctgc gctcctggac cgccgcggac acggcggctc       660
     agatctccca gcgcaagttg gaggcggccc gtgtggcgga gcagctgaga gcctacctgg       720
     agggcgagtg cgtggagtgg ctccgcagat acctggagaa cgggaaggac aagctggagc       780
     gcgctg                                                                  786
//